Information report for orange1.1g044161m
Gene Details
|
|
Functional Annotation
- Refseq: XP_024037428.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024037429.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024037430.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024037431.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024037432.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024037433.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024037434.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024037436.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024037437.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024948485.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024948486.1 — transcription factor MYB27 isoform X1
- Refseq: XP_024948487.1 — transcription factor MYB27 isoform X2
- Refseq: XP_024948488.1 — transcription factor MYB27 isoform X2
- Refseq: XP_024948489.1 — transcription factor MYB27 isoform X2
- Refseq: XP_024948490.1 — transcription factor MYB27 isoform X2
- Refseq: XP_024948491.1 — transcription factor MYB27 isoform X2
- Refseq: XP_024948492.1 — transcription factor MYB27 isoform X2
- Refseq: XP_024948493.1 — transcription factor MYB27 isoform X2
- Refseq: XP_024948494.1 — transcription factor MYB27 isoform X2
- Refseq: XP_024948495.1 — transcription factor MYB27 isoform X2
- Swissprot: Q9SCP1 — MYB27_ARATH; Transcription factor MYB27
- TrEMBL: A0A067E5L0 — A0A067E5L0_CITSI; Uncharacterized protein
- STRING: XP_006491683.1 — (Citrus sinensis)
- GO:0010200 — Biological Process — response to chitin
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cucumis sativus: Cucsa.306580.1
- Fragaria vesca: mrna09683.1-v1.0-hybrid
- Glycine max: Glyma.13G145800.1.p
- Gossypium arboreum: Cotton_A_25408_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A04G0594, Gh_D04G1055
- Malus domestica: MDP0000819856, MDP0000221801
- Populus trichocarpa: Potri.006G122100.1
- Prunus mume: XP_008241450.2
- Prunus persica: Prupe.7G126800.1.p
- Pyrus bretschneideri: Pbr035306.1, Pbr020777.1
- Ziziphus jujuba: XP_015898439.1
Sequences
CDS Sequence:
- >orange1.1g044161m|Citrus_sinensis|MYB|orange1.1g044161m
ATGCAAGAAGAGAAATTGAGCAAGGGGCCTTGGCACGAGGAAGAAGATGAGTTACTTGTAACATTTGTAACTCTTTTTGGGGAGCGAAGATGGGATTACATAGCTAAAGCATCTGGTCTAAAGAGGAGTGGCAAGAGTTGCGGGTTGCGATGGCTGAATTATCTTTGTCCAAATATTAAGCACGGGTATATAAGCACTGAAGAGGAACAGATCATCATTCAACTTCATAAGAAATGGGGTAACAAGTGGTCGAGGATTGCACGAAACTTGCCTGGAAGAACTGATAACGAGATCAAGAATTATTGGAGAACTCGTATTAGAAAGAAAATTCAAGCTCAAGAGCAAGAGAACTTTCAATTTGGAAGAAACAATGCCAAGCGAGATTCCTTATTTTCGAATCTTGATTTTAATGTGCAAAAGCACGAGACTGATGATGAACACAAGCCTGGGGAGAATCCTTTTGGAACTGACAACTCATTCGATGTTCTTGGGTTTCCAAACTCTGCATTTGCAAGTTCACCATACAAAATCCGGATTCGAGATTGGATGTCAGAGTTATCGGATGATCAAAGTAAAATAACACAGCAGGGTGGTTCTAACATTGTGGAGTCATGTTTTGGATGCCAGGCAAGCATTGCAGAATATACTGATACATGGGGTTGGTCAGGCTCAATTTGGGATATGAATTAA
Protein Sequence:
- >orange1.1g044161m|Citrus_sinensis|MYB|orange1.1g044161m
MQEEKLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQEQENFQFGRNNAKRDSLFSNLDFNVQKHETDDEHKPGENPFGTDNSFDVLGFPNSAFASSPYKIRIRDWMSELSDDQSKITQQGGSNIVESCFGCQASIAEYTDTWGWSGSIWDMN*