Information report for MELO3C009708P1
Gene Details
|
|
Functional Annotation
- Refseq: XP_008443185.1 — PREDICTED: myb-related protein 306-like
- Swissprot: B3VTV7 — MYB60_VITVI; Transcription factor MYB60
- TrEMBL: A0A1S3B7E9 — A0A1S3B7E9_CUCME; myb-related protein 306-like
- TrEMBL: E5GBY1 — E5GBY1_CUCME; MYB transcription factor
- STRING: XP_008443185.1 — (Cucumis melo)
- GO:0009414 — Biological Process — response to water deprivation
- GO:0009416 — Biological Process — response to light stimulus
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010118 — Biological Process — stomatal movement
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_18047
- Citrullus lanatus: Cla017463
- Cucumis sativus: Cucsa.337320.1
- Daucus carota: DCAR_009089
- Gossypium arboreum: Cotton_A_18881_BGI-A2_v1.0, Cotton_A_22356_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A11G2037, Gh_D11G2341
- Juglans regia: WALNUT_00011695-RA
- Lotus japonicus: Lj1g3v4012910.1
- Malus domestica: MDP0000163673, MDP0000168550
- Manihot esculenta: Manes.09G135700.1.p
- Populus trichocarpa: Potri.013G067500.1, Potri.019G045900.1
- Prunus mume: XP_008240570.1
- Prunus persica: Prupe.7G018400.1.p
- Pyrus bretschneideri: Pbr016839.1
- Ricinus communis: 29818.m000395
- Vitis vinifera: GSVIVT01029904001
- Ziziphus jujuba: XP_015899725.1
Sequences
CDS Sequence:
- >MELO3C009708P1|Cucumis_melo|MYB|MELO3C009708P1
ATGGGAAGGCCTCCATGTTGTGAGAAAGTAGGGATAAAGAAAGGGCCATGGACTCCTGAAGAAGATATCATTCTTGTTTCTTACATTCAACAACATGGCCCTGGCAATTGGAGATCAGTTCCTACTAACACAGGATTGTTGCGTTGTAGCAAAAGTTGTAGACTTAGATGGACGAATTATCTTAGGCCAGGAATTAAAAGAGGCAATTTCACTCCTCATGAAGAAGGAATGATCATTCATCTTCAAGCTTTATTGGGTAACAAATGGGCAGCGATAGCATCGTACCTTCCTCAAAGAACAGATAATGATATCAAAAATTATTGGAACACTCACTTGAAAAAGAAGCTTAAAAAATTGAATTCCGCCGCCGTCGACCCCCCGGAGCCGCCTGAATCCGCCCCCTCTCGCTTTCAATCCAATGATAAAGTTTCGGCTGCCGATTCACCGTCGTCGCTCGCCGGAAACAGAGCCGCCACCACTTACGCCTCAAGCGCCGAGAACATTTCCCGGCTTCTTCAAGCTTGGATGAGATCTTCACCGGAAGAATCTCGACGGAAAATCGGCGGTGAGAATTCTATAGCCCCCGCCACGCAGCAGCAGCAGCCGAAGGCAGAGCCAGACGGCAGGGAGTTGGTTTCCGGTGAAGAATTTGATTCGATTTTATCGTTCGAGAATTTGAAGAGTGTGAATTCGTGGGGGAAATCGAGTTTGAGTTATAAGGGTAAAGAGGAAGTTAATGTTGGAGAGAAACAGAGATCAGAGAACGATGAGGCTACTGCGGCGAATGCGACGGCGCCGCCGCTATCGTTTCTTGAGAAGTGGCTGTTTGAAGAAGGCGCCGCCGGGCAAGTGGAAGAGATGATGGAGTTATCGCCGGTGTTCTAG
Protein Sequence:
- >MELO3C009708P1|Cucumis_melo|MYB|MELO3C009708P1
MGRPPCCEKVGIKKGPWTPEEDIILVSYIQQHGPGNWRSVPTNTGLLRCSKSCRLRWTNYLRPGIKRGNFTPHEEGMIIHLQALLGNKWAAIASYLPQRTDNDIKNYWNTHLKKKLKKLNSAAVDPPEPPESAPSRFQSNDKVSAADSPSSLAGNRAATTYASSAENISRLLQAWMRSSPEESRRKIGGENSIAPATQQQQPKAEPDGRELVSGEEFDSILSFENLKSVNSWGKSSLSYKGKEEVNVGEKQRSENDEATAANATAPPLSFLEKWLFEEGAAGQVEEMMELSPVF*