Information report for MELO3C001981P1
Gene Details
|
|
Functional Annotation
- Refseq: XP_008442096.1 — PREDICTED: myb-related protein 306-like
- Swissprot: P81392 — MYB06_ANTMA; Myb-related protein 306
- TrEMBL: A0A1S3B5N8 — A0A1S3B5N8_CUCME; myb-related protein 306-like
- STRING: XP_008442096.1 — (Cucumis melo)
- GO:0009414 — Biological Process — response to water deprivation
- GO:0009651 — Biological Process — response to salt stress
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0010468 — Biological Process — regulation of gene expression
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_39469
- Capsicum annuum: CA03g30090
- Citrullus lanatus: Cla018610
- Citrus sinensis: orange1.1g019307m
- Cucumis sativus: Cucsa.112760.1
- Fragaria vesca: mrna26007.1-v1.0-hybrid
- Glycine max: Glyma.04G170100.1.p, Glyma.06G193600.2.p, Glyma.06G193600.1.p
- Nicotiana benthamiana: Niben101Scf12143g00001.1
- Nicotiana tabacum: XP_016450803.1, XP_016504410.1
- Prunus mume: XP_008239949.1
- Prunus persica: Prupe.5G193200.1.p
- Ricinus communis: 30138.m004082
- Sesamum indicum: XP_011071639.1
- Solanum lycopersicum: Solyc03g116100.2.1
- Solanum tuberosum: PGSC0003DMP400033945
Sequences
CDS Sequence:
- >MELO3C001981P1|Cucumis_melo|MYB|MELO3C001981P1
ATGGGAAGGCCACCTTGTTGTGATAAAATTGGTGTAAAGAAAGGGCCATGGACTCCTGAAGAAGATATCATCTTAGTTTCTTACATTCAAGAACATGGGCCTGGCAATTGGAGATCAGTTCCAACTAACACTGGTTTGTTAAGATGTAGCAAGAGCTGTCGATTGAGATGGACTAATTACCTTCGTCCTGGTATCAAGCGTGGCAATTTCACTGATCATGAAGAAAAGATGATAATTCACCTCCAAGCTCTTTTGGGCAACAGATGGGCAGCTATAGCATCGTATCTTCCACAAAGAACGGATAACGATATAAAGAACTACTGGAACACGCACTTGAAAAAGAAGCTGAGGAAGATGCAGTCTTTAGGAGGAGGAGGAGGGAGTGAGGGAAGTGGTGTGCAATCACAGAGTAATACAACACTTTCAAAAGGGCAGTGGGAAAGAAGGCTTCAAACAGATATTCACACAGCCAAAAAAGCCCTTTGTGAAGCACTTTCCCTTGAAAAGAAGCCTAATTTAGAGGAATATTATTATAACAATAATCTCAAGATCCTTCAAGAATCACCAACAGCACCAACACCACCACCACAGACAACAACTACTACTACTACTTATGCATCAAGTGCTGAAAATATTGCAAGATTGCTAGAGAATTGGATGAAGAAATCACCAACAAAATCATCAGAAATTACAACAACAACACAAGTTTGTATGAGTGAAGAAGGATCACAAATTAGTGCAACCAATAATTACAATAATAACTCACCAGATCATCAAAAGCCCAACAACAACAACAATTTGGAGGGCTTCTTCAATAATTATTCTTCCCACTCAACAACAAACGATCAAGAAGCTGTAGTTCCTCTTACTTTTCTTGAGAAGTGGTTGTTTGATGATGCAGCTTTGGCTCATGTTCATGATGACGATGATCATCAGTTAATTAGTGTGTCATTAGATGAAGCTCAAAGCGAAGGTTTGTTTTAA
Protein Sequence:
- >MELO3C001981P1|Cucumis_melo|MYB|MELO3C001981P1
MGRPPCCDKIGVKKGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYLRPGIKRGNFTDHEEKMIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKLRKMQSLGGGGGSEGSGVQSQSNTTLSKGQWERRLQTDIHTAKKALCEALSLEKKPNLEEYYYNNNLKILQESPTAPTPPPQTTTTTTTYASSAENIARLLENWMKKSPTKSSEITTTTQVCMSEEGSQISATNNYNNNSPDHQKPNNNNNLEGFFNNYSSHSTTNDQEAVVPLTFLEKWLFDDAALAHVHDDDDHQLISVSLDEAQSEGLF*