Information report for MDP0000708334
Gene Details
|
|
Functional Annotation
- Refseq: XP_008369906.2 — transcription factor AS1 isoform X1
- Swissprot: O80931 — AS1_ARATH; Transcription factor AS1
- TrEMBL: A0A498K3X5 — A0A498K3X5_MALDO; Uncharacterized protein
- STRING: XP_008369905.1 — (Malus domestica)
- GO:0008356 — Biological Process — asymmetric cell division
- GO:0009615 — Biological Process — response to virus
- GO:0009651 — Biological Process — response to salt stress
- GO:0009733 — Biological Process — response to auxin
- GO:0009739 — Biological Process — response to gibberellin
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0009944 — Biological Process — polarity specification of adaxial/abaxial axis
- GO:0010338 — Biological Process — leaf formation
- GO:0042742 — Biological Process — defense response to bacterium
- GO:0045088 — Biological Process — regulation of innate immune response
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0050832 — Biological Process — defense response to fungus
- GO:0000793 — Cellular Component — condensed chromosome
- GO:0005730 — Cellular Component — nucleolus
- GO:0003677 — Molecular Function — DNA binding
- GO:0042803 — Molecular Function — protein homodimerization activity
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Citrus sinensis: orange1.1g018783m, orange1.1g018768m
- Fragaria vesca: mrna18421.1-v1.0-hybrid, mrna08535.1-v1.0-hybrid
- Prunus mume: XP_008240925.1, XP_008240916.1, XP_008240909.1, XP_008240901.1
- Prunus persica: Prupe.6G255800.4.p, Prupe.6G255800.3.p, Prupe.6G255800.2.p, Prupe.6G255800.1.p, PRUPE_6G255800
- Pyrus bretschneideri: Pbr033541.1
- Rosa chinensis: RchiOBHm_Chr3g0466491
- Ziziphus jujuba: XP_015896997.1, XP_015896996.1, XP_015896995.1, XP_015896994.1, XP_015896993.1
Sequences
CDS Sequence:
- >MDP0000708334|Malus_domestica|MYB|MDP0000708334
ATGAAGGAGAGACAGCGTTGGAGTGCTGAAGAGGACGCTTTGTTACGTGCATATGTGAAGCAATATGGACCAAGGGAGTGGAACCTTGTATCGCAGCGCATGAACACACCCCTAGACAGGGATGCTAAATCTTGCTTAGAAAGGTGGAAGAATTATCTCAAACCCGGCATTAAGAAAGGATCCCTAACTGAAGAGGAGCAGCGCCTTGTCATTTGTCTTCAAGCCAAACACGGTAATAAGTGGAAGAAAATTGCTGCTGAAGTCCCTGGTCGTACGGCTAAGAGATTGGGAAAGTGGTGGGAAGTGTTCAAAGAGAAGCAGCAAAGAGAACAGAAGAACAAGAAGATAACTGACCCTATTGTGGAGGGTAAATACGATACAATACTTGAAACTTTTGCCGAGAAGTTGGTGAAGGAGCGTGCGCCAACCTATCTCATGGCTACTTCAAACGGGGCCTATCTTCATACGGAAACATCTTCTCCAGCGCCAACGATTCTTCCTCCTTGGCTTTCTAATTCCAGTGTGTCCCCCAATGTGAGGCCACCATCTCCTTCTGTTACCCTGAGTCTGTCCCCGACAGTGGCACCCTCTCCGCCAATCCCTTGGCTGCAGCAGGATCGAGGATCAGATGGTAGTTTTGTTGTGGGAAATTTGCCACATCATGGTGTAGTTCCCGCTTGTGGGGAGAACCTAGTGATATCTGAGTTGGTGGAGTGCTCCAGAGAGTTGGAGGAAATGCACCGTGCTTGGGCAGYGCATAAGAAGGAAGCTTCGTGGAGGTTAAGAAGGGTGGAGTTGCAACTGGATTCGGAGAAGGCTTGTCGGAGGAGGGAGAAGATGGAAGAGATTGAAGCCAAGGTGAAGGCTCTAAGGGAAGAGCAGAAGGCTGCTCTAGACAGGATCGAAGCAGAATACAGGGAACAGTTAGCAGGGCTAAGGAGGGATGCAGAAGCAAAGGAGCAGAAGTTGGCTGAGCAATGGGCCGCGAAGCATTTGCGTCTCTCCCAGTTTCTCGAGCAGATGGGAGGCAGACCAAGGATTGTTGAGCCTAACGGCCGGTGA
Protein Sequence:
- >MDP0000708334|Malus_domestica|MYB|MDP0000708334
MKERQRWSAEEDALLRAYVKQYGPREWNLVSQRMNTPLDRDAKSCLERWKNYLKPGIKKGSLTEEEQRLVICLQAKHGNKWKKIAAEVPGRTAKRLGKWWEVFKEKQQREQKNKKITDPIVEGKYDTILETFAEKLVKERAPTYLMATSNGAYLHTETSSPAPTILPPWLSNSSVSPNVRPPSPSVTLSLSPTVAPSPPIPWLQQDRGSDGSFVVGNLPHHGVVPACGENLVISELVECSRELEEMHRAWAXHKKEASWRLRRVELQLDSEKACRRREKMEEIEAKVKALREEQKAALDRIEAEYREQLAGLRRDAEAKEQKLAEQWAAKHLRLSQFLEQMGGRPRIVEPNGR*