Information report for Lus10039213
Gene Details
|
|
Functional Annotation
- Refseq: XP_002318818.3 — transcription factor LAF1
- Refseq: XP_011048709.1 — PREDICTED: transcription factor LAF1-like isoform X2
- Swissprot: Q9M0K4 — LAF1_ARATH; Transcription factor LAF1
- TrEMBL: B9I499 — B9I499_POPTR; Uncharacterized protein
- STRING: Lus10039213 — (Linum usitatissimum)
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0010018 — Biological Process — far-red light signaling pathway
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Capsicum annuum: CA07g03650
- Cicer arietinum: XP_004496837.1
- Glycine max: Glyma.20G157900.2.p
- Gossypium arboreum: Cotton_A_01315_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A12G2333
- Juglans regia: WALNUT_00004355-RA
- Malus domestica: MDP0000896053
- Manihot esculenta: Manes.14G026300.1.p, Manes.06G146600.1.p
- Medicago truncatula: Medtr1g100667.1
- Nicotiana benthamiana: Niben101Scf02910g01031.1
- Populus trichocarpa: Potri.012G140500.1
- Prunus mume: XP_008234256.1
- Prunus persica: Prupe.2G293700.1.p
- Solanum melongena: Sme2.5_03714.1_g00001.1
- Ziziphus jujuba: XP_015878099.1, XP_015878037.1
Sequences
CDS Sequence:
- >Lus10039213|Linum_usitatissimum|MYB|Lus10039213
ATGGAAGAATGCAAAGACCAGAAGCCAACGAAGCCCAAGCACCGGAAGGGCTTGTGGTCGCCGGAGGAAGACCACCGCCTCCGTAGCTACATCGTTAAGAACGGCCACGGCTGCTGGACCACCGTCCCCATCAACGCCGGCCTTCAAAGAAATGGAAAGAGTTGCAGGCTAAGGTGGATTAATTATCTACGGCCAGGATTAAGGCGCGGTTTGTTTTCCGCTCATGAAGAAGACACAATCGTGACCCTTCATCGTCTCCTCGGTAATAAGTGGTCACAGATCTCGCAACATTTACCAGGACGAACCGACAATGAAATCAAAAACCATTGGCACTCGTATCTCAAGAAAAAGTTAACGAAATCTCAAGGAATTGCTTCAAACGACAATAATAATAATAAGATCCAACAATTTCCTAGCTCCTCTAACTCCGACAATAACCCAAGCACCAACCACAACCTCTCGCAGGACCACCGCGACGAGCCCGCACTGTCGTCCACGACAACATCAGCCACCGATAAGTACTCTGTCCCGTTGTTGCCACCGAAACTCATATTCGCCGAGTGGCTATCGATGGACAGCTTCCCCACCAATCCAGCTGCCGAACCGTTGTTTTGTGATAGGGATTTCGCTAGTGGGAGCAGCGAGTATGGTCTTGACATCCCAAATAGCGGATTCTTCAGTGATCATTTGTTTCAAGGCGGGTACCAACTTTGTGGCGAAAGAGGAGGGTATCGGAACTCGATGGCCACAACGGTGAGCGATGGATCAGCCAGCGACGTGTTTTCGTCACAGTTTAATTTCGAAGATCAGAGTTCGGACAACAGTAGTCAGTTCGTTGAGTTCTGCAGCGATTTCCAGATCAATAGTGACAGTGTTTTGTATATATGA
Protein Sequence:
- >Lus10039213|Linum_usitatissimum|MYB|Lus10039213
MEECKDQKPTKPKHRKGLWSPEEDHRLRSYIVKNGHGCWTTVPINAGLQRNGKSCRLRWINYLRPGLRRGLFSAHEEDTIVTLHRLLGNKWSQISQHLPGRTDNEIKNHWHSYLKKKLTKSQGIASNDNNNNKIQQFPSSSNSDNNPSTNHNLSQDHRDEPALSSTTTSATDKYSVPLLPPKLIFAEWLSMDSFPTNPAAEPLFCDRDFASGSSEYGLDIPNSGFFSDHLFQGGYQLCGERGGYRNSMATTVSDGSASDVFSSQFNFEDQSSDNSSQFVEFCSDFQINSDSVLYI*