Information report for GSMUA_Achr4P23690_001
Gene Details
|
|
Functional Annotation
- Refseq: XP_018680483.1 — PREDICTED: myb-related protein P-like isoform X2
- TrEMBL: M0SRI0 — M0SRI0_MUSAM; Uncharacterized protein
- STRING: GSMUA_Achr4P23690_001 — (Musa acuminata)
- GO:0009555 — Biological Process — pollen development
- GO:0009789 — Biological Process — positive regulation of abscisic acid-activated signaling pathway
- GO:0043068 — Biological Process — positive regulation of programmed cell death
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0090406 — Cellular Component — pollen tube
- GO:0003677 — Molecular Function — DNA binding
- GO:0003824 — Molecular Function — catalytic activity
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Citrus sinensis: orange1.1g039708m
- Cucumis melo: MELO3C018820P1
- Hordeum vulgare: MLOC_6041.1
- Manihot esculenta: Manes.11G009900.6.p, Manes.11G009900.5.p, Manes.11G009900.4.p, Manes.11G009900.3.p, Manes.11G009900.2.p, Manes.11G009900.1.p
- Nicotiana tabacum: XP_016446856.1
- Populus trichocarpa: Potri.003G189700.1, Potri.003G189700.4
- Setaria italica: Seita.9G181600.1.p
- Setaria viridis: Sevir.9G180500.1.p
- Vitis vinifera: GSVIVT01030434001
Sequences
CDS Sequence:
- >GSMUA_Achr4P23690_001|Musa_acuminata|MYB|GSMUA_Achr4P23690_001
ATGAAGGCCGAGGAAGGAGAAAGAGGAGGGAAGAAGGCGGAAAGGGGGCTGAAGAAGGGGCCGTGGACGCCGGCGGAGGACGCGATCCTGGTGGAGCATGTGAGGCGGCACGGGGAGGGGAACTGGAATGCGGTGCAGCGGCACAGCGGGCTGGCGCGCTGCGGCAAGAGCTGCCGCCTCCGTTGGGCCAACCACCTCCGCCCCAACCTCAAGAAGGGATCCTTCACACCCGACGAGGAGCTCCTCATCCTTCGCCTCCACGCCCAGCTCGGCAATAAATGGGCGCGCATGGCCGCTCAGCTCCCGGGAAGGACGGACAATGAGATTAAGAACTACTGGAACACCCGCCTCAAGCGCCGGCAGCGCGCCGGCCTTCCCATCTACCCGCCGGAGCTGCAAGAGGCCGTCGGATTCGATCACCAGCTGAAGCAACAGGCTTCGACGTTGCTCCGGACGCCGCCGCCGCTGCCACCTCCGCCTTCCGCCGCGGAGTTCAGCGCCCGGCTCCCCTCCTTGCGGCCCGCCCCGTTGCTGGATCCCGCCATTTTTCGGCCTTCGTCGGGGATGACTCTGCCTCCCCTCCCGCAAAATCTGTTCTCCTGTCACCTCGGTTTTGGATTCCCGCTCTCGCCCGCCTCGCCGCCGCCGACGCCAACCTCTCTTTTTCAGCCGCAGCAGCAGCTTGGGCCGGGAAATTATGAAGTAAGCCGGCCGCAGCGGCTGCCGCCGGTGCCGTGGCCAACGATGGCGAAAATGGAGCTCCCTTCATGCCAATTGTTCCCGGAACCCGTCGGAGGCCGCGACGGTCTTACCAGCAGCGGCCTGCTCGAGGCTCTGCTGCAGGACGCCCATGTCCCCGAGGATATGAAGCTCGGGGAGCTCTTGGCACTGCCAACCGTCGGCGAGCAGGAAGCGGTGTGGGAGCACGTCTTCTTCGGCGGCGATAGCAGCGAAGCCATCAAGGAGACTTCTCAAGGCTGCTCCTTGGGATCCGCCACGAAGTTGGAAGGCTTGGATTGCGACATGGGTGAGTTCTATCGAACTAATCCTCCTGTTTCCGTTCCATGTGTTGGTAGTCTCTGCATTAGAACTACTAATATGAGATAA
Protein Sequence:
- >GSMUA_Achr4P23690_001|Musa_acuminata|MYB|GSMUA_Achr4P23690_001
MKAEEGERGGKKAERGLKKGPWTPAEDAILVEHVRRHGEGNWNAVQRHSGLARCGKSCRLRWANHLRPNLKKGSFTPDEELLILRLHAQLGNKWARMAAQLPGRTDNEIKNYWNTRLKRRQRAGLPIYPPELQEAVGFDHQLKQQASTLLRTPPPLPPPPSAAEFSARLPSLRPAPLLDPAIFRPSSGMTLPPLPQNLFSCHLGFGFPLSPASPPPTPTSLFQPQQQLGPGNYEVSRPQRLPPVPWPTMAKMELPSCQLFPEPVGGRDGLTSSGLLEALLQDAHVPEDMKLGELLALPTVGEQEAVWEHVFFGGDSSEAIKETSQGCSLGSATKLEGLDCDMGEFYRTNPPVSVPCVGSLCIRTTNMR