Gene Details:
- Gene ID: Glyma.15G176000.1.p
- Gene Name: GLYMA_15G176000
- Gene Family: MYB Family
- Description: MYB Family protein
- Species: Glycine max
- Source: MYB family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:1.10.10.60
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- SMART: SM00717
- Pfam: PF00249
- InterPro: IPR009057 IPR017930 IPR001005
Annotation Proteins:
- Refseq: NP_001237452.2 — transcription factor MYBZ1
- Refseq: XP_028203378.1 — transcription factor TT2-like
- Swissprot: Q9FJA2 — TT2_ARATH; Transcription factor TT2
- TrEMBL: A0A445GUU5 — A0A445GUU5_GLYSO; Transcription factor TT2 isoform A
- TrEMBL: I1MHE2 — I1MHE2_SOYBN; Uncharacterized protein
- STRING: GLYMA15G19360.1 — (Glycine max)
Gene Ontology:
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature:
- The R2R3-MYB gene family in Arabidopsis thaliana. DOI: 10.1016/s1369-5266(00)00199-0 ; PMID: 11597504
Sequences:
CDS Sequence:
- >Glyma.15G176000.1.p|Glycine_max|MYB|Glyma.15G176000.1.p
ATGGAAACGAAGGACGACAGTGCTGAAAAAGAAGAAGCTTGGTCTTCTCATGAAGACGAAATTCTTTTGAACTATGTTCAAGTCCGTGGAGAAGGAAATTGGAGAAACCTTCCTAAAAGAGCTGGCTTGAAACGATGTGGTGAGAGTTGCAAACAACGATGGTTGAACTATCTTAAGCCAACCATATCTAGAGGAAACATTTCTTTAGATGAACATGAACTCATAATCAGACTGCATAAGCTCTTGGGGAATAGTAACTATACGTGCCGCAGATGGTCTATCATTGCTGGACGATTACCAGGACGCACCGAAGAAGAGATCAAGAACTACTGGAATACCTATTTGAGAAAGGAGGCAGAAGAGAACCAAAACAATAAGAACGAATTTCCAAGCACAAGTATGACAACAACTAGCATGTCTAGTGTTCAATCTCCATGGTACTCCGAAAATTCCGTAGGTACCAATCCCACGGAATCTCCAAATCCTGTGATTAGACCTAAAGTTGTGAGGTTATCTAAGTTTAATTTGTCGTGCCAAGACAGGTAG
Protein Sequence:
- >Glyma.15G176000.1.p|Glycine_max|MYB|Glyma.15G176000.1.p
METKDDSAEKEEAWSSHEDEILLNYVQVRGEGNWRNLPKRAGLKRCGESCKQRWLNYLKPTISRGNISLDEHELIIRLHKLLGNSNYTCRRWSIIAGRLPGRTEEEIKNYWNTYLRKEAEENQNNKNEFPSTSMTTTSMSSVQSPWYSENSVGTNPTESPNPVIRPKVVRLSKFNLSCQDR*