Information report for EMT27766
Gene Details
Functional Annotation
- Refseq: XP_020168349.1 — transcription factor MYB6
- Swissprot: Q9M2D9 — MYB17_ARATH; Transcription factor MYB17
- TrEMBL: A0A3B6QFJ2 — A0A3B6QFJ2_WHEAT; Uncharacterized protein
- TrEMBL: A0A453P5Y3 — A0A453P5Y3_AEGTS; Uncharacterized protein
- TrEMBL: M8CVE2 — M8CVE2_AEGTA; Transcription factor MYB39
- STRING: EMT27766 — (Aegilops tauschii)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0009909 — Biological Process — regulation of flower development
- GO:0048443 — Biological Process — stamen development
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Brachypodium distachyon: Bradi3g49987.1.p
- Hordeum vulgare: MLOC_39554.2, MLOC_68698.1
- Oryza sativa: OsMYB38, OsMYB57
- Panicum virgatum: Pavir.1KG410700.1.p, Pavir.1NG369300.1.p
- Setaria italica: Seita.1G250900.1.p
- Setaria viridis: Sevir.1G255100.1.p
- Triticum aestivum: Traes_2AL_41B71F83C.1, Traes_2BL_79F1B50DF.1
- Zea mays: GRMZM2G040924_P01, GRMZM2G111045_P01
Sequences
CDS Sequence:
- >EMT27766|Aegilops_tauschii|MYB|EMT27766
ATGGGGAGGGCGCCGTGCTGCGACAGGAAGGGTCTCAAGAAGGGGCCGTGGACGCCGGAGGAGGACAAACAGCTCGTCGACTTCATCCAGGCCAACGGCCATGGCAGCTGGCGCCTGCTCCCCAAACTCGCAGAGCTGAACCGGTGCGGCAAGAGCTGCCGGCTACGGTGGACGAACTACCTGCGGCCGGACATCAAGCGCGGGCCCTTCACCGCCGAGGAGCAGAAGTCCATCGTCCAGCTCCACGGCATCGTCGGGAACAAGTGGTCCATGATCGCGGCGCAGCTGCCCGGCCGGACGGACAACGAGATCAAGAACTACTGGAACACGCACCTCAAGAAGCAGCTCCGCCGGATGGGCCTCGACGAGCCCCCGCCCGGCCCGACCGCCGGCTGCCCCGCCGCGCGCCACATGGCGCAGTGGGAGACCGCGCGCCTGGAGGCCGAGGCGCGCCTCTCGCTCCTCTCCTCCTCCGGCGCCGCGGCGACGGCCACCACCTCCGGCTCCGCGTCCTCTTCATCGACCGCGGCCGCCGGCGCCGCGGTGGCCGAACGCGCGAAGCCCGCCGACGTCTTCCTGCGCCTGTGGAACTCCGATATCGGGAGCTCTTTCCGCAAAGCGGCCGCGCCAGTGTCCGTCAAGGAGGAGGAGGCTGTGGTGCCGGGGGACGACTCCTCGGCGGCGTCCAACGAGATGGACGCGGCGGCGGCCGAGTACCAGATGTTCCTCGACTTCGCCGGCGAGGAGCTGGGTCTGTTCCACGGCCGGCACGGCGGCTTCTCGCTGTTCCCGCCGCTCGACGTGCTCGCCGAGGCGTCCCTGGACACGGCGTTCTAG
Protein Sequence:
- >EMT27766|Aegilops_tauschii|MYB|EMT27766
MGRAPCCDRKGLKKGPWTPEEDKQLVDFIQANGHGSWRLLPKLAELNRCGKSCRLRWTNYLRPDIKRGPFTAEEQKSIVQLHGIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMGLDEPPPGPTAGCPAARHMAQWETARLEAEARLSLLSSSGAAATATTSGSASSSSTAAAGAAVAERAKPADVFLRLWNSDIGSSFRKAAAPVSVKEEEAVVPGDDSSAASNEMDAAAAEYQMFLDFAGEELGLFHGRHGGFSLFPPLDVLAEASLDTAF