Information report for EMT23269
Gene Details
Functional Annotation
- Refseq: XP_020201589.1 — myb-related protein Zm38-like
- TrEMBL: A0A3B6JJS6 — A0A3B6JJS6_WHEAT; Uncharacterized protein
- TrEMBL: M8BMX8 — M8BMX8_AEGTA; Transcription repressor MYB4
- STRING: EMT23269 — (Aegilops tauschii)
- STRING: Traes_4DL_DFCF4A15A.1 — (Triticum aestivum)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0048658 — Biological Process — anther wall tapetum development
- GO:0052545 — Biological Process — callose localization
- GO:0055046 — Biological Process — microgametogenesis
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Brachypodium distachyon: Bradi1g65238.2.p
- Hordeum vulgare: Bmy2
- Oryza sativa: OsTDF1
- Panicum virgatum: Pavir.4NG165600.1.p, Pavir.4KG248800.1.p
- Setaria italica: Seita.4G173600.1.p
- Setaria viridis: Sevir.4G142300.1.p
- Triticum aestivum: Traes_4DL_DFCF4A15A.1, Traes_4AS_4EFBA88E4.1, Traes_4BL_532725AD5.1
- Zea mays: GRMZM2G308034_P01
Sequences
CDS Sequence:
- >EMT23269|Aegilops_tauschii|MYB|EMT23269
ATGGGGCGGCCGCCGTGCTGCGACAAGGCCAACGTGAAGAAGGGGCCGTGGACGGCGGAGGAGGACGCCAAGCTGCTCGCCTACACCTCCAACCATGGCACCGGCAACTGGACCTCTGTTCCCCAGAGGGCAGGGCTGAAGCGGTGCGGGAAGAGCTGCAGGCTGAGGTACACCAACTACCTGAGGCCCAACCTCAAGCACGAGAACTTCACGCAGGAGGAGGAGGAGCTCATCGTCACCCTCCATGCCATGCTGGGAAGCAGGTGGTCTCTGATCGCGAACCAGCTGCCGGGGCGGACGGACAACGACGTCAAGAACTACTGGAACACCAAGCTGAGCAAGAAGCTGAGGCAGCGGGGCATCGACCCCATCACCCACCGCCCCATCGCCGATCTCATGCAGAGCATCGGCACCCTCGCCATCCGCCCGCCACCGAGCGCCGCGGGTGCCTCCTCCTCCTCCTACCTCCCCGTGAACCCACCGGCGGCGCCGGGGCTCCAGCCGCTGCACGACGACGTCAAATACCACACAGTCCTGAACCAGCAGCAGCAGCAGGTCATCACGCTCCTCGACCCCGACGCGCCAGGGGCGGCGGCGTCCCCGGAGCACCAGCTCAAGTGGAGCGACTTCCTCGCGGACGACGCCGCGGCCCTCGAGGCGGCGCCGCAGGTCGTTCTTGGTCAGTACCAGGAGGCCGCGGTCGCTGGTGGCGGAGCACACGCGTATGGCGACACTGACAGTACTGCAGCCGATGGTGTCGGCGGGGGCGGGGACGATAGCGCAGCGTCAGCGTTCATCGACGCGATGCTGGACAGCGACAAGAAGATGGGCGTGGACCAGCTCATCGCCGACCTGCTCGCCGACCCGGCATACTACTACGGCGGAGGCTCTTCCTCTTCGACGTCGGAGCTGGGGTGGGGCTGTTGA
Protein Sequence:
- >EMT23269|Aegilops_tauschii|MYB|EMT23269
MGRPPCCDKANVKKGPWTAEEDAKLLAYTSNHGTGNWTSVPQRAGLKRCGKSCRLRYTNYLRPNLKHENFTQEEEELIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPITHRPIADLMQSIGTLAIRPPPSAAGASSSSYLPVNPPAAPGLQPLHDDVKYHTVLNQQQQQVITLLDPDAPGAAASPEHQLKWSDFLADDAAALEAAPQVVLGQYQEAAVAGGGAHAYGDTDSTAADGVGGGGDDSAASAFIDAMLDSDKKMGVDQLIADLLADPAYYYGGGSSSSTSELGWGC