Gene Details:

  • Gene ID: EcC054909.320
  • Gene Family: MYB Family
  • Description: MYB Family protein
  • Species: Eucalyptus camaldulensis
  • Source: MYB family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010045019.1  — PREDICTED: transcription factor MYB46
  • Swissprot:  Q9LXV2  — MYB46_ARATH; Transcription factor MYB46
  • TrEMBL:  A0A059D989  — A0A059D989_EUCGR; Uncharacterized protein
  • STRING:  XP_010045019.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0001678  — Biological Process — cellular glucose homeostasis
  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0006413  — Biological Process — translational initiation
  • GO:0006468  — Biological Process — protein phosphorylation
  • GO:0007165  — Biological Process — signal transduction
  • GO:0008033  — Biological Process — tRNA processing
  • GO:0015074  — Biological Process — DNA integration
  • GO:0046835  — Biological Process — carbohydrate phosphorylation
  • GO:0055114  — Biological Process — oxidation-reduction process
  • GO:0005622  — Cellular Component — intracellular
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003743  — Molecular Function — translation initiation factor activity
  • GO:0003924  — Molecular Function — GTPase activity
  • GO:0004396  — Molecular Function — hexokinase activity
  • GO:0004553  — Molecular Function — hydrolase activity, hydrolyzing O-glycosyl compounds
  • GO:0004672  — Molecular Function — protein kinase activity
  • GO:0005506  — Molecular Function — iron ion binding
  • GO:0005515  — Molecular Function — protein binding
  • GO:0005524  — Molecular Function — ATP binding
  • GO:0005525  — Molecular Function — GTP binding
  • GO:0005536  — Molecular Function — glucose binding
  • GO:0008270  — Molecular Function — zinc ion binding
  • GO:0016705  — Molecular Function — oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
  • GO:0016783  — Molecular Function — sulfurtransferase activity
  • GO:0020037  — Molecular Function — heme binding
  • GO:0050662  — Molecular Function — coenzyme binding

Family Introduction:

  • MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
  • In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.

Literature:

Sequences:

CDS Sequence:
  • >EcC054909.320|Eucalyptus_camaldulensis|MYB|EcC054909.320
    ATGAGGAAACCCGATGCCTCTGGGAAGAACAGCTCCAACAGCAACGCTAACAAGCTGAGAAAAGGACTCTGGTCGCCTGAAGAGGACGACAAGTTGATGAACTACATGCTCAACAATGGCCAAGGCTGCTGGAGCGATGTGGCCCGGAACGCCGGGCTGCAGCGGTGTGGCAAGAGTTGCCGCCTCCGGTGGATCAACTACTTGCGGCCCGACCTCAAGAGGGGCGCTTTCTCCCCACAAGAGGAGGAGCTGATCATCCACTTGCATTCCATCCTTGGCAACAGGTGGTCGCAAATCGCGGCTCGGTTGCCGGGACGGACTGACAACGAAATAAAGAACTTTTGGAACTCGACCATAAAGAAGAGGCTCAAGAATTCGTCATCATCTTCTTGTAGACACTCGCCAAACACGAGCGATTCCTCCTTGTCATCAGACGTTAAAGATGTCATGGGAGGTCTCATCTCCCTTCAGGAACAAGGACTCATGCCACTTTATATGGACTCGTTGTCGTCCGTGCAAGCTTTGGCTCTTAACCAGATTATCGATCCATTACTACCCTCACTCAACCAAGGCCTCGACCTCCCCGGTTTAAGTGGATACTGTGATGCAAATTCCAATTACTGCGCAGTGCAAGGCGGAGTTAGCGGTGAATTCGGGAGATTCGGAGGTGTTGCTGGTTGTGGCAGTAATGGAGATCAACTCTATGTTCCTCCACTAGAGAGCATAAGCATTGAAAATGTGAAAACTGAGAACACATATGACAGCGAACACAATAGCAGCAACGACCTTAGTAACTTCAACTATACCACTGATGATGTCGTTGATAACATAGGCAACTTTAACGACTATGGCAGAATAGAAAGCATGGCTGGTCTGGGGAACTTGTGGAACGGAGGAGAGGAGATGAAAGTGGGGGAATGGGACTTGGAGGAGTTGATGAAAGATGTCTCTTCATTTTCTTCTTCTGATTTCCAGGTTATTCATTAG
Protein Sequence:
  • >EcC054909.320|Eucalyptus_camaldulensis|MYB|EcC054909.320
    MRKPDASGKNSSNSNANKLRKGLWSPEEDDKLMNYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYLRPDLKRGAFSPQEEELIIHLHSILGNRWSQIAARLPGRTDNEIKNFWNSTIKKRLKNSSSSSCRHSPNTSDSSLSSDVKDVMGGLISLQEQGLMPLYMDSLSSVQALALNQIIDPLLPSLNQGLDLPGLSGYCDANSNYCAVQGGVSGEFGRFGGVAGCGSNGDQLYVPPLESISIENVKTENTYDSEHNSSNDLSNFNYTTDDVVDNIGNFNDYGRIESMAGLGNLWNGGEEMKVGEWDLEELMKDVSSFSSSDFQVIH