Information report for Cla015165
Gene Details
Functional Annotation
- Refseq: XP_008461407.1 — PREDICTED: transcription factor MYB108-like
- Swissprot: Q2QZJ8 — JAMYB_ORYSJ; Transcription factor JAMYB
- TrEMBL: A0A1S3CEB9 — A0A1S3CEB9_CUCME; transcription factor MYB108-like
- STRING: XP_008461407.1 — (Cucumis melo)
- GO:0009414 — Biological Process — response to water deprivation
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0016036 — Biological Process — cellular response to phosphate starvation
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0005634 — Cellular Component — nucleus
- GO:0001046 — Molecular Function — core promoter sequence-specific DNA binding
- GO:0005516 — Molecular Function — calmodulin binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Citrus sinensis: orange1.1g043269m
- Cucumis melo: MELO3C023633P1
- Cucumis sativus: Cucsa.128620.1, Cucsa.128620.2
- Gossypium arboreum: Cotton_A_23218_BGI-A2_v1.0
- Gossypium hirsutum: Gh_D11G1132, Gh_A11G0981
- Juglans regia: WALNUT_00030246-RA
- Manihot esculenta: Manes.05G012100.1.p
- Nicotiana benthamiana: Niben101Scf03049g06001.1
- Nicotiana tabacum: XP_016511320.1
- Pyrus bretschneideri: Pbr008630.1
- Ricinus communis: 30076.m004607
- Vitis vinifera: GSVIVT01028171001
Sequences
CDS Sequence:
- >Cla015165|Citrullus_lanatus|MYB|Cla015165
ATGGATGTTAAAATGAGAGGTTTTAGGTGTGCAGAACCTCAGAGGACAAAAGAGGAGGAGATGGACGTCCGGAAAGGCCCTTGGACGGCGGAGGAGGATTCCGTTCTGTTCAATTATATTAATTGCCACGGCGAAGGCCGCTGGAACGCCGTTGCTCGTTGCACTGGTTTGAAGAGAACCGGTAAGAGTTGTAGATTGAGATGGTTAAATTATTTGAGGCCGAGTGTTAGGCGTGGCAATATCACTCTCCAAGAACAGCTCTTGATTCTTGACCTCCATTTTCGTTGGGGCAACAGGTGGTCTAAAATAGCACAATATTTACCGGGAAGAACCGACAATGAAATAAAAAATTATTGGAGAACAAGGGTTCAAAAGCAAGCCAAGCAACTCAATTGTGACGTGAACAGCAAGCAATTCCGTGACGCCATGCGATATGTGTGGATGCCCCGTTTGCTCGAACGTATCCAAGCCTCAACTGACTCGACCACCACCACCGTTGATGTCATCCAACCACCACACCCTCCTCTCGAGTTGACCCAATCGTCATCGTCTAGATCTAGTTGGGTCAACCCTCATGTGGCTCCCACAACTTCATCGTCAGACTCTATATCTGATCAGGTACAACTTCAAGTTTCGCCTGTCTCAGACGTGATCGAGAACTTTAACTTGGTAGGCTCGAGCGAGGAGGACAGGATGGTGATGCTAATGGAACACGGCTGTGACGGAGAGACGATGAATGGGTGGATAGGTGGCGGAGAGTTATTGGAGAATGGGTTTTGGAATGGAGAAGATATGTGGTCGTTCTTGGAACAACAGTTTGGTGATGATGTTTAA
Protein Sequence:
- >Cla015165|Citrullus_lanatus|MYB|Cla015165
MDVKMRGFRCAEPQRTKEEEMDVRKGPWTAEEDSVLFNYINCHGEGRWNAVARCTGLKRTGKSCRLRWLNYLRPSVRRGNITLQEQLLILDLHFRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKQAKQLNCDVNSKQFRDAMRYVWMPRLLERIQASTDSTTTTVDVIQPPHPPLELTQSSSSRSSWVNPHVAPTTSSSDSISDQVQLQVSPVSDVIENFNLVGSSEEDRMVMLMEHGCDGETMNGWIGGGELLENGFWNGEDMWSFLEQQFGDDV