Information report for Cla009078
Gene Details
Functional Annotation
- Refseq: XP_004149865.1 — PREDICTED: transcription factor DIVARICATA-like
- Refseq: XP_011655162.1 — PREDICTED: transcription factor DIVARICATA-like
- Refseq: XP_011655163.1 — PREDICTED: transcription factor DIVARICATA-like
- Refseq: XP_011655164.1 — PREDICTED: transcription factor DIVARICATA-like
- Refseq: XP_011655165.1 — PREDICTED: transcription factor DIVARICATA-like
- Refseq: XP_011655166.1 — PREDICTED: transcription factor DIVARICATA-like
- Swissprot: Q9FNN6 — SRM1_ARATH; Transcription factor SRM1
- TrEMBL: A0A0A0KTA8 — A0A0A0KTA8_CUCSA; Uncharacterized protein
- STRING: XP_004149865.1 — (Cucumis sativus)
- STRING: XP_004172523.1 — (Cucumis sativus)
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_20830
- Citrus sinensis: orange1.1g022439m
- Cucumis melo: MELO3C005072P1
- Cucumis sativus: Cucsa.013870.5, Cucsa.013870.4, Cucsa.013870.3, Cucsa.013870.2, Cucsa.013870.1
- Glycine max: Glyma.07G175500.6.p, Glyma.07G175500.5.p, Glyma.07G175500.4.p, Glyma.07G175500.3.p, Glyma.07G175500.2.p, Glyma.07G175500.1.p
- Juglans regia: WALNUT_00031212-RA
- Lotus japonicus: Lj0g3v0221649.1
- Manihot esculenta: Manes.11G001300.3.p, Manes.11G001300.2.p, Manes.11G001300.1.p
- Populus trichocarpa: Potri.005G087700.3, Potri.005G087700.2, Potri.005G087700.1
Sequences
CDS Sequence:
- >Cla009078|Citrullus_lanatus|MYB|Cla009078
ATGACTGTTGATGAAGCAGGAAGTAGCTCCTTGTGGAGTTTAGAACAGGACAAGGCATTTGAGAATGCACTTGCAAGTCATCCTGAGGATGATTCGGATCGGTGGGAGAAAATTGCATTCGATGTACCAGGGAAAACCATAGAAGAGATTAAACATCACTACGAGCTCTTAGTTGAGGATGTTAATCTAATTGAATCGGGTTGTGTGCCTCTTCCTTCCTATAGTTCTTCTTCAGATGGTTCAGCCAGCCATGCTGGTGATGAAGGAACAACTAAGAAGAATGGCCATTTTGGGCACTGTAATGGTGATTCAAATCATGGAACTAAGACTTCAAGGTCAGATCAAGAACGCCGTAAGGGGATTGCTTGGACAGAGGATGAACACAGATTGTTTCTACTTGGTCTCGATAAATACGGGAAAGGAGACTGGCGGAGTATATCCCGAAACTTTGTCGTGACGAGAACACCAACGCAAGTGGCAAGCCATGCACAAAAATATTTCATCCGTTTGAACTCAATGAACAAAGAAAGGAGGCGGTCCAGCATCCACGATATCACCAGCGTTACGAACGGAGATATCTCGGCTGCTCAAGGGCCGATCACCGGTCAAGCAAACGGCTCTGGAGCAGCTCCCTCTGGAAAACCAACAAAACAGCCTCCTCAATCTGCAGCTGGTCCTCCTGGTGTGGGAATGTATGGTGGTCCAACAATGGGGCAGCCAGTGGGTGGTCCGCTCGTCTCAGCTGTTGGCACCCCTGTCAGTCTCCCTGCTCCTGCTCATATGGCATATGGAGTCCAAGCTCCAGTGCCCGGCACAGTGGTTCCCGGTGCACCTGTAAACATGGGTCCGATGACGTATCCAATGCCACACACATCTGCTCATAGGTAA
Protein Sequence:
- >Cla009078|Citrullus_lanatus|MYB|Cla009078
MTVDEAGSSSLWSLEQDKAFENALASHPEDDSDRWEKIAFDVPGKTIEEIKHHYELLVEDVNLIESGCVPLPSYSSSSDGSASHAGDEGTTKKNGHFGHCNGDSNHGTKTSRSDQERRKGIAWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKYFIRLNSMNKERRRSSIHDITSVTNGDISAAQGPITGQANGSGAAPSGKPTKQPPQSAAGPPGVGMYGGPTMGQPVGGPLVSAVGTPVSLPAPAHMAYGVQAPVPGTVVPGAPVNMGPMTYPMPHTSAHR