Information report for Cla007586
Gene Details
Functional Annotation
- Refseq: XP_008460645.1 — PREDICTED: myb-related protein Myb4-like
- Swissprot: Q9LTC4 — MYB15_ARATH; Transcription factor MYB15
- Swissprot: Q9SJX8 — MYB14_ARATH; Transcription factor MYB14
- TrEMBL: A0A1S3CCG5 — A0A1S3CCG5_CUCME; myb-related protein Myb4-like
- STRING: XP_008460645.1 — (Cucumis melo)
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009733 — Biological Process — response to auxin
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010200 — Biological Process — response to chitin
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Brassica napus: GSBRNA2T00154860001
- Capsicum annuum: CA00g88900
- Cucumis melo: MELO3C022997P1
- Cucumis sativus: Cucsa.383620.1
- Glycine max: Glyma.02G005600.1.p, GmMYB29A2
- Gossypium arboreum: Cotton_A_01697_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A07G1385, Gh_D07G1491
- Juglans regia: WALNUT_00027759-RA
- Nicotiana benthamiana: Niben101Scf03064g05001.1, Niben101Scf03570g04002.1, Niben101Scf00501g00004.1
- Nicotiana tabacum: XP_016465608.1, XP_016493387.1, XP_016487815.1, XP_016490215.1
- Solanum lycopersicum: Solyc09g090130.2.1
- Solanum melongena: Sme2.5_00962.1_g00008.1
- Solanum tuberosum: PGSC0003DMP400030100
Sequences
CDS Sequence:
- >Cla007586|Citrullus_lanatus|MYB|Cla007586
ATGGGGAGAGCTCCATGCTGTGAGAAAATGGGCTTGAAAAAAGGGCCTTGGTCTCCTGAAGAAGATAGAATTTTGACCAATTTTATTCAGAATCATGGCCATAGCAATTGGCGAGCTCTTCCTAAACAAGCTGGTCTTTTAAGATGTGGGAAAAGTTGTAGACTTCGTTGGACAAACTATTTGAGACCTGATATTAAGAGAGGCAACTTCACCAAAGAAGAAGAAGACGCCATTATTAACCTACACGAATTGCTTGGCAATAGATGGTCAGCAATAGCAGCCAAGCTACCGGGTCGAACAGACAATGAAATCAAGAATGTTTGGCACACCCACCTGAAGAAAAGGCTTGAAAAAAATATCATAAAAAAAACAACAGCTTCCAAATCTGAAAACAAAAGAAAAAAACAAATAAAACCATCAAATTCTTCTTCATCCATTATTATTGATATTACAAACCAAAACCAAGTTGCCAATTATTCTTCAACAATGTCCCCTTCTTCACAACAATCCTCGAGCTGTGAGATCTCTTCATCACTCACAGATCATACTTGCATGACTGAAAGTGAGTACTACAGCTACACGGCGGAGGACACCGCGACGGCTCCTCCACCGATCGATGAGAGCTTTTGGTCCGAGGTGGTCGAGAATTCAACGACGAATTCCTATTCTGATTCGAATTCAAATTCAAATATTTATGATAGTGAAGAGAAAATGGAGGAATTCCCATCGATGTCCATGAATATGGTGGAAACAAATTCGGATAAGAGATTATATGGTCAATGTGTTGCTGATGATGACATGGAATTTTGGTACAATGTTTTTGTCAAAGCTGGAGAAATTTCTGAATTGCCAGAATTTTGA
Protein Sequence:
- >Cla007586|Citrullus_lanatus|MYB|Cla007586
MGRAPCCEKMGLKKGPWSPEEDRILTNFIQNHGHSNWRALPKQAGLLRCGKSCRLRWTNYLRPDIKRGNFTKEEEDAIINLHELLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLEKNIIKKTTASKSENKRKKQIKPSNSSSSIIIDITNQNQVANYSSTMSPSSQQSSSCEISSSLTDHTCMTESEYYSYTAEDTATAPPPIDESFWSEVVENSTTNSYSDSNSNSNIYDSEEKMEEFPSMSMNMVETNSDKRLYGQCVADDDMEFWYNVFVKAGEISELPEF