Information report for Ciclev10026107m
Gene Details
|
|
Functional Annotation
- Refseq: XP_006425988.1 — transcription factor MYB44
- Swissprot: O23160 — MYB73_ARATH; Transcription factor MYB73
- TrEMBL: A5HLW5 — A5HLW5_CITSI; Putative R2R3-Myb transcription factor
- TrEMBL: V4RWL5 — V4RWL5_9ROSI; Uncharacterized protein
- STRING: XP_006425988.1 — (Citrus clementina)
- GO:0009723 — Biological Process — response to ethylene
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010200 — Biological Process — response to chitin
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0044212 — Molecular Function — transcription regulatory region DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Citrullus lanatus: Cla013979
- Citrus sinensis: orange1.1g021071m, orange1.1g023744m
- Cucumis sativus: Cucsa.102710.1
- Gossypium arboreum: Cotton_A_26928_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A11G0440, Gh_D11G0511, Gh_A11G2008
- Juglans regia: WALNUT_00012236-RA
- Malus domestica: MdMYB6, MDP0000629440
- Manihot esculenta: Manes.12G108500.1.p
- Populus trichocarpa: Potri.007G048900.1, Potri.007G048900.2, Potri.005G142600.1
- Pyrus bretschneideri: Pbr015309.1, Pbr025199.1
- Ricinus communis: 29970.m000987
- Ziziphus jujuba: XP_015890262.1, XP_015865918.1
Sequences
CDS Sequence:
- >Ciclev10026107m|Citrus_clementina|MYB|Ciclev10026107m
ATGGCGTTTAATAGAAGAGAAGTGGATCGGATCAAAGGTCCATGGAGCCCCGAAGAAGACGAAGCCTTACAGCAGCTGGTTCAAAAACACGGCCCAAGAAATTGGTCTCTAATCAGCAAATCAATTCCCGGAAGATCGGGAAAGTCTTGCCGGCTACGGTGGTGCAACCAGCTGTCACCTCAAGTCGAGCACCGAGCGTTCACGCCCGAAGAAGACGAGATGATCATACGAGCCCACGCTCGGTTTGGCAACAAGTGGGCCACCATCGCGCGCCTTCTCAACGGCCGAACCGATAACGCGATTAAGAATCACTGGAACTCGACCTTAAAACGTAAGTGCTCTTCGATGTTGACAGAGAACGGTATTTTTTTGAATTGTAATGGATACGATGCGGATTTTGGGAATAGTATTCAGCAACAGCCGTTGAAATTGAAAAGATCGGTGAGTGCGGGATCGAGTGTGCCCGTGACCACGGGACTTTATATGAGCCCCGGTAGTCCATCGGGATCCGACGTCAGCGATTCAAGCGTGCCGGGTTTGTCATCGAATTACAATATATACAAACCCGTGGCGAGATCTGGCGGTATCAATGTGGACGTGAATGTGGTGCCCGAGCCGGAAACGACGTCGTCGTCTAATGACCCTCCTACTTCATTGAGTCTGTCCCTTCCTGGTGTGGATTCCTCCTCAGAAGTTTCAAACAAAGTGAGTGAGTCAACTCAGGCAGTGAACGCAAAAGCTTCGGTGCCGGCTCCAGTAAGTAGTGACAGTGGGTCGAAGGGATTAGTGGGGTTTAGTAAAGAGTTTATGGCTGTGATGCAGGAGATGATAAAGCAGGAAGTGAGGACGTACATGGCGGCGCTTGAGCAGCAGAGAGGTGGCGCGTGTTATAACGGTAGTGGTGGGGGCGGTGATGGGGTTTTAAGGAATGTTGCCATGCAAAGGACTGGTTAG
Protein Sequence:
- >Ciclev10026107m|Citrus_clementina|MYB|Ciclev10026107m
MAFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENGIFLNCNGYDADFGNSIQQQPLKLKRSVSAGSSVPVTTGLYMSPGSPSGSDVSDSSVPGLSSNYNIYKPVARSGGINVDVNVVPEPETTSSSNDPPTSLSLSLPGVDSSSEVSNKVSESTQAVNAKASVPAPVSSDSGSKGLVGFSKEFMAVMQEMIKQEVRTYMAALEQQRGGACYNGSGGGGDGVLRNVAMQRTG*