Information report for Ciclev10012152m
Gene Details
|
|
Functional Annotation
- Refseq: XP_006431144.1 — myb-related protein 306
- Swissprot: P81392 — MYB06_ANTMA; Myb-related protein 306
- TrEMBL: V4UX79 — V4UX79_9ROSI; Uncharacterized protein
- STRING: XP_006431144.1 — (Citrus clementina)
- GO:0001666 — Biological Process — response to hypoxia
- GO:0009617 — Biological Process — response to bacterium
- GO:0009626 — Biological Process — plant-type hypersensitive response
- GO:0009723 — Biological Process — response to ethylene
- GO:0009733 — Biological Process — response to auxin
- GO:0009739 — Biological Process — response to gibberellin
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0042761 — Biological Process — very long-chain fatty acid biosynthetic process
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Citrus sinensis: orange1.1g018746m
- Gossypium hirsutum: Gh_D04G0446, Gohir.D04G049200
- Juglans regia: Jr01_00260, WALNUT_00028043-RA
- Manihot esculenta: MANES_02G046100, Manes.02G046100.1.p
- Populus trichocarpa: Potri.017G082500.1, POPTR_004G126700v3, Potri.004G126700.1
- Prunus mume: XP_008230764.1
- Prunus persica: PRUPE_3G268000, Prupe.3G268000.2.p, Prupe.3G268000.1.p
- Ziziphus jujuba: XP_015879369.1
Sequences
CDS Sequence:
- >Ciclev10012152m|Citrus_clementina|MYB|Ciclev10012152m
ATGGGGAGGCCACCTTGTTGTGACAAAATTGGTATCAAGAAAGGGCCATGGACTCCAGAAGAAGATATCATTTTAGTTTCTTATATTCAAGAGCATGGCCCTGGAAATTGGAGGGCTGTTCCCACTAATACAGGATTGCTTAGATGCAGCAAAAGTTGCAGGCTTAGATGGACTAATTACCTAAGGCCAGGGATCAAGCGTGGGAATTTCACTGATCAAGAAGAGAAGATGATAATTCATCTGCAAGCACTTTTGGGCAACAGATGGGCGGCTATTGCTTCTTATCTCCCTCAGAGAACTGACAATGACATCAAGAACTATTGGAATACTCACTTGAAGAAGAAGGTGAGGAAGCTGCAACTAGCTGCTGCTGGCTGCTCTGAAGATAATAGCCAATATAGAGATGAGCTAGCTTCAGCTTCTTCACAGCAAATCTCAAGGGGTCAGTGGGAGAGAAGGCTGCAGACTGATATTCACATGGCTAAGCAAGCTCTATGTGCGGCCTTGTCACCAGATAAAGCGAGTATTTTGTCTGAATTGAAGCCTGCTAATGGGTTCATTTCCTACACAAAACCAGCAGTTCAAGCACCAGCTTACGCTTCAAGCACTGAGAACATTGCTAAGTTGCTCAAAGGGTGGACCAGAAACGCTCAAAAAAGTGCTTCTTCGAACTCAGGTGTTACTGATCAGAATTCAATTAATAACAATGTTAATCACATTGCTGGGGCAGAATCTGCTTCTAGTGAAGAGACTCCAAGCAAAGTTGCAAGCAACAGTACTGGCATAGAATTATCAGAGGCTTTTGAATCGTTGTTTGGTTTTGAGTCTTTTGATTCGTCAAATTCTACCGATTTATCTCAATCTGTGACCCCTGAGTCTAGCACTTTTCAAGATTATGAGAGCAAGCAATTGTTATTAGATCCTAGTGCTGGTGCTGATGATGATCAAATGCCACAGCTGTCATTGCTTGAGAAGTGGCTTTTTGATGATCAAGGAGGGAAAGATATCTAA
Protein Sequence:
- >Ciclev10012152m|Citrus_clementina|MYB|Ciclev10012152m
MGRPPCCDKIGIKKGPWTPEEDIILVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYLRPGIKRGNFTDQEEKMIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKVRKLQLAAAGCSEDNSQYRDELASASSQQISRGQWERRLQTDIHMAKQALCAALSPDKASILSELKPANGFISYTKPAVQAPAYASSTENIAKLLKGWTRNAQKSASSNSGVTDQNSINNNVNHIAGAESASSEETPSKVASNSTGIELSEAFESLFGFESFDSSNSTDLSQSVTPESSTFQDYESKQLLLDPSAGADDDQMPQLSLLEKWLFDDQGGKDI*