Information report for CA11g04240
Gene Details
|
|
Functional Annotation
- Refseq: XP_016571686.1 — PREDICTED: uncharacterized protein LOC107869748
- TrEMBL: A0A1U8GK91 — A0A1U8GK91_CAPAN; Transcription factor MYB44
- TrEMBL: A0A2G2YDY5 — A0A2G2YDY5_CAPAN; uncharacterized protein LOC107869748
- STRING: Solyc05g007870.1.1 — (Solanum lycopersicum)
- GO:0010199 — Biological Process — organ boundary specification between lateral organs and the meristem
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Juglans regia: WALNUT_00023008-RA, WALNUT_00013582-RA
- Manihot esculenta: Manes.05G103300.3.p, Manes.05G103300.2.p, Manes.05G103300.1.p
- Nicotiana benthamiana: Niben101Scf04082g07002.1
- Nicotiana tabacum: XP_016456515.1, XP_016457765.1
- Petunia inflata: Peinf101Scf03525g01020.1
- Populus trichocarpa: Potri.008G088000.1, Potri.010G167500.2, Potri.010G167500.1
- Prunus mume: XP_016647029.1
- Prunus persica: Prupe.1G276300.1.p
- Sesamum indicum: XP_011070989.1, XP_011075638.1
- Solanum lycopersicum: Solyc05g007870.1.1
- Solanum melongena: Sme2.5_03125.1_g00003.1
- Solanum tuberosum: PGSC0003DMP400032103
- Vitis vinifera: GSVIVT01019967001
Sequences
CDS Sequence:
- >CA11g04240|Capsicum_annuum|MYB|CA11g04240
ATGGGTGGTGCTTCTACTTCAATGGGGATGTTTTTTGCTGATATGAATTCACTTTCCATAAATACTCCCAAAAGTGTTGACGAGGGTAAAGGGAGGAAGGGTTCTTGGGATTTTCAATTCTTGAATAAAGGTGGGGCAGTTTTTTCTTGTTGTCAGAATCTTGATGAAGTCCAAAATAGTGAAGAAAATAATGAGAGTATTGATCTTAATGCTTCTTGCTACAATGAAGAGAAACAAATTACACTGCATAGTACTTTTAATAGTAATAATAGCAGTAGTGGTGGTGGTGGTGGTAATAATGGTAAGGAGACAGAGAGTGGTCAATCAAAGCTTTGTGCTAGAGGCCATTGGAGACCAGCTGAAGATGCACAACTTAAAGAACTTGTTGCTATTTATGGCCCTCAGAATTGGAATCTTATAGCAGAAAAGTTAGAAGGAAGATCAGGAAAAAGTTGTAGATTGAGGTGGTTTAACCAGTTGGATCCAAGAATTAACAGGAGGGCATTTAGTGAAGAGGAAGAGGAAAGATTAATGGCAGCTCATAGATTGTATGGTAACAAATGGGCAATGATAGCAAGGCTATTTCCAGGGAGAACAGATAATGCAGTGAAGAATCATTGGCATGTAATAATGGCTAGAAAATATAGAGAACAATCAAGTGCTTATAGGAGGAGGAAAATGGGACAATTTGTTTATAGAAGATCAACACTAGTAGTTGAAGAAGCAGATAGTGGCAAAGCACAAGCACCAATTATCAGTTGCCAAAATTCTGTTAACCAATTTGGTGCCACTGCTAATACTACTAGTGTGAAAATAAATAATGATGGTCCAAATGGTTGGGTTGTTTATGAACCAAATGGCTCACCCCACATGACTGTTTCTGCTGGAGAAGCAGCAGCAGCAACCCCTAGCAGCACCAATAATGTCACTCTCCTTTCTCCTTATTCACCATTTTGTGCTCCCCCTTTTGACTCATTACCTGCAGGTATATTTCGGTCCATCCCTTTTAACAATTTGTTTCATCAACTTAAATTCTGA
Protein Sequence:
- >CA11g04240|Capsicum_annuum|MYB|CA11g04240
MGGASTSMGMFFADMNSLSINTPKSVDEGKGRKGSWDFQFLNKGGAVFSCCQNLDEVQNSEENNESIDLNASCYNEEKQITLHSTFNSNNSSSGGGGGNNGKETESGQSKLCARGHWRPAEDAQLKELVAIYGPQNWNLIAEKLEGRSGKSCRLRWFNQLDPRINRRAFSEEEEERLMAAHRLYGNKWAMIARLFPGRTDNAVKNHWHVIMARKYREQSSAYRRRKMGQFVYRRSTLVVEEADSGKAQAPIISCQNSVNQFGATANTTSVKINNDGPNGWVVYEPNGSPHMTVSAGEAAAATPSSTNNVTLLSPYSPFCAPPFDSLPAGIFRSIPFNNLFHQLKF*