Information report for CA01g24400
Gene Details
|
|
Functional Annotation
- Refseq: XP_016557269.1 — PREDICTED: myb-related protein Myb4-like isoform X1
- Refseq: XP_016557274.1 — PREDICTED: myb-related protein Myb4-like isoform X2
- Swissprot: O22264 — MYB12_ARATH; Transcription factor MYB12
- TrEMBL: A0A1U8FND9 — A0A1U8FND9_CAPAN; myb-related protein Myb4-like isoform X1
- TrEMBL: A0A1U8FNE4 — A0A1U8FNE4_CAPAN; Transcription repressor MYB6
- TrEMBL: A0A2G3AL08 — A0A2G3AL08_CAPAN; myb-related protein Myb4-like isoform X2
- STRING: XP_009622107.1 — (Nicotiana tomentosiformis)
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009733 — Biological Process — response to auxin
- GO:0009813 — Biological Process — flavonoid biosynthetic process
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Nicotiana benthamiana: Niben101Scf01623g12020.1, Niben101Scf04819g00002.1, Niben101Scf03390g12008.1
- Nicotiana tabacum: XP_016480310.1, XP_016508470.1, XP_016482665.1
- Solanum lycopersicum: Solyc01g079620.2.1, Solyc06g009710.2.1, Solyc12g049350.1.1
- Solanum melongena: Sme2.5_11221.1_g00002.1
- Solanum tuberosum: PGSC0003DMP400015891, PGSC0003DMP400015892, PGSC0003DMP400012935, PGSC0003DMP400007770
Sequences
CDS Sequence:
- >CA01g24400|Capsicum_annuum|MYB|CA01g24400
ATGGGAAGAGCGCCTTGTTGTGAGAAAGTGGGTCTAAAGAGAGGCAGATGGACTGCCGAAGAAGATCAAATTCTCACTAATTACATTCTTTCTAACGGTGAAGGCTCTTGGAGGTCATTGCCCAAAAATGCTGGATTGCTGAGATGTGGAAAGAGTTGCAGACTTAGATGGATTAATTACTTGAGGTCTGATTTGAAGAGAGGTAACATAACCTCTCAAGAGGAAAACATAATCATTAAGTTGCATGCTACTTTGGGCAACAGATGGTCTTTAATAGCCGGACATTTGCCAGGTAGAACAGACAATGAGATAAAAAATTATTGGAACTCTCATCTAAGCAGAAAAGTTGAAAGCTTAAGAATACCAAGCGATGAAAAACTGCCTCAAGCTGTAGTTGATTTGGCTAAAAAGGGTGCATTGATGCCAATTAAACAAAGCAGAAAAACAAGTCGAATATCCAATATGAAGAAAAATAAAACGTCAAAGAATTCAAACTTGGCAGAGCCTAAGGAAGCTAAAGAAAATAGTACTAGTGGACCTTTGAGTGCATCAGCAGTTTCTATTCCCTCAACACTAAACATGGAAAAAGAGGCATTGTCTAGTACTATTAGCTCATGGCTAGATGGTAAGAACATGCCAGCTAGTGATAGTGCCATGGATTCAATGCAAGAAGATGTAGCAGACGTAGCGGCGCCAAATCCTAGGGTGGGGTCTAGAGAGTCCCACAGCAGCCTTAGTTCAGGTAAATTATTCATATTTTTAAGTTATTATGTACGCTTATGTATGTACGGATCTAGTTTTTTTAATAATCGTTATGATATGGAAAGAACTTAA
Protein Sequence:
- >CA01g24400|Capsicum_annuum|MYB|CA01g24400
MGRAPCCEKVGLKRGRWTAEEDQILTNYILSNGEGSWRSLPKNAGLLRCGKSCRLRWINYLRSDLKRGNITSQEENIIIKLHATLGNRWSLIAGHLPGRTDNEIKNYWNSHLSRKVESLRIPSDEKLPQAVVDLAKKGALMPIKQSRKTSRISNMKKNKTSKNSNLAEPKEAKENSTSGPLSASAVSIPSTLNMEKEALSSTISSWLDGKNMPASDSAMDSMQEDVADVAAPNPRVGSRESHSSLSSGKLFIFLSYYVRLCMYGSSFFNNRYDMERT*