Information report for CA01g02130
Gene Details
|
|
Functional Annotation
- Refseq: XP_016552744.1 — PREDICTED: transcription factor MYB86
- TrEMBL: A0A2G3ADP8 — A0A2G3ADP8_CAPAN; Protein ODORANT1
- STRING: Solyc08g081500.1.1 — (Solanum lycopersicum)
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:1901430 — Biological Process — positive regulation of syringal lignin biosynthetic process
- GO:2000652 — Biological Process — regulation of secondary cell wall biogenesis
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_13238
- Glycine max: Glyma.08G017600.1.p
- Gossypium arboreum: Cotton_A_39594_BGI-A2_v1.0
- Gossypium hirsutum: Gh_D08G1266, Gh_A08G0993
- Manihot esculenta: Manes.01G057200.1.p
- Nicotiana benthamiana: Niben101Scf00254g01002.1, Niben101Scf35850g00003.1
- Nicotiana tabacum: XP_016444911.1, XP_016483081.1, XP_016451731.1, XP_016454091.1
- Populus trichocarpa: Potri.003G132000.1, Potri.001G099800.1
- Sesamum indicum: XP_011074190.1
- Solanum lycopersicum: Solyc08g081500.1.1
- Vitis vinifera: GSVIVT01019410001
Sequences
CDS Sequence:
- >CA01g02130|Capsicum_annuum|MYB|CA01g02130
ATGGGGCACCATTCATGCTGTAATCAACAAAAGGTAAAGAGAGGACTTTGGTCCCCAGAAGAAGATGAAAAGCTTATCAGATATATTACTTCTCATGGTTATGGCTGCTGGAGTGAAGTCCCTGAGAAAGCTGGGCTACAAAGATGTGGAAAAAGTTGTCGTTTGAGATGGATCAATTATTTGAGGCCTGATATTAGAAGAGGAAGATTTACCCCTGAAGAAGAAAAATTGATTATCAGTCTCCATGGTGCTGTTGGCAACAGATGGGCACATATCGCAAGTCATTTACCCGGAAGAACAGATAACGAGATAAAAAATTACTGGAACTCTTGGATTAAAAAGAAGCTGAAAAAGCCTTCAAAGCCATCAGCAAACACAACTTCTATTACTGATCATCATCACCAGCAGTCACATCAAAGATCTCAATTGGTTAATTACAACACAATTACAAGCCAACAAGACATATTTTTCACTCAAGATCTTGGAACAAAATCTCAAGTACTCCTCCAAGATTCTACCCTATTCAATTCTCCAAGCCAATTGTTCTTTTTCGACAGTGGTTCACTCGACTCTATGACAAATGCTATTATTAATGATGCCACAAATCGAAGTACTACTACTAATAATGCCTCGTTGTTTCAAGAAACATCTACATTGAACTCAGAGTTCTGCTGGCAAGTCGATCAACAACAACAACAACAACTTCAAGTACAGACATCTTCGTACGCGATAGGGATGGATTCGAATTATTTGCCACCATTGATAGAGAGTATGGTACCACCTATGGAAATACCCCGTAATAATAACAACAACAACAATATTATGGTGGAAGGGCAAGAAAATAATAATCAATTGGATGAATGGAGTAGTCAAGTGGACACACAACAATGTTGTCCAAGTTATCTATTTTGGGATCAAGAAAATGGATCAATTGGTGGTGATCATGAGATCAATATAGATCCAACTACATCAAACAATATGGGACAAATATTATCTTCTTTTCCTTCTTCTTTATGA
Protein Sequence:
- >CA01g02130|Capsicum_annuum|MYB|CA01g02130
MGHHSCCNQQKVKRGLWSPEEDEKLIRYITSHGYGCWSEVPEKAGLQRCGKSCRLRWINYLRPDIRRGRFTPEEEKLIISLHGAVGNRWAHIASHLPGRTDNEIKNYWNSWIKKKLKKPSKPSANTTSITDHHHQQSHQRSQLVNYNTITSQQDIFFTQDLGTKSQVLLQDSTLFNSPSQLFFFDSGSLDSMTNAIINDATNRSTTTNNASLFQETSTLNSEFCWQVDQQQQQQLQVQTSSYAIGMDSNYLPPLIESMVPPMEIPRNNNNNNNIMVEGQENNNQLDEWSSQVDTQQCCPSYLFWDQENGSIGGDHEINIDPTTSNNMGQILSSFPSSL*