Information report for CA00g61780
Gene Details
|
|
Functional Annotation
- Refseq: XP_016549644.1 — PREDICTED: myb-related protein 308-like
- Swissprot: P10290 — MYBC_MAIZE; Anthocyanin regulatory C1 protein
- TrEMBL: A0A1U8F0G3 — A0A1U8F0G3_CAPAN; Anthocyanin regulatory C1 protein
- TrEMBL: A0A2G2Y956 — A0A2G2Y956_CAPAN; myb-related protein 308-like
- STRING: Solyc12g049300.1.1 — (Solanum lycopersicum)
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Beta vulgaris: Bv_000930_crae.t1
- Fragaria vesca: mrna07416.1-v1.0-hybrid
- Juglans regia: WALNUT_00000737-RA
- Malus domestica: MDP0000887107, MdMYB123, MDP0000140609
- Nicotiana benthamiana: Niben101Scf03965g03007.1, Niben101Scf00797g01001.1
- Nicotiana tabacum: XP_016444317.1, XP_016448289.1, XP_016444318.1
- Prunus mume: XP_008228205.1
- Prunus persica: Prupe.3G042300.1.p
- Pyrus bretschneideri: Pbr031682.1
- Solanum lycopersicum: Solyc12g049300.1.1
- Solanum melongena: Sme2.5_02955.1_g00006.1
- Ziziphus jujuba: XP_015865646.1, XP_015868130.1
Sequences
CDS Sequence:
- >CA00g61780|Capsicum_annuum|MYB|CA00g61780
ATGGGTAGAAAGCCTTGTTGTTCTAAAGAGGGATTAAACAAAGGTGCGTGGACTCCGATCGAGGATAAAATTCTAATAGATTACATCAAAGTTCATGGTGAAGGGAAATGGAGAAATCTTCCCAATAGAGCTGGTCTTAAAAGATGTGGAAAGAGTTGTAGACTAAGGTGGTTGAATTATCTAAGGCCAGATATCAAGAGGGGAAATATAAGTCCAGATGAAGAGGATCTCATAATCAGACTTCACAAGCTTCTTGGAAACAGATGGTCTCTTATTGCCGGAAGGCTACCAGGACGAACAGACAATGAAATCAAGAACTACTGGAACACCAACATTGAAAGAAAACTTCAAGAAGCAAAAGGTTCTGGTCAGCCAAATCGCGTAACGTCTTCATATCGTCAGCGCAATCGCTCTAGTCATGCCAAATCAGCCAACCCAAGCCCAATTACCCAACTACAGCAAAATAATCAAGAACAAACAATTCAGCAAGATTCAAATTGTCTACTACAAACAGACGTTGGACGTGAAGGATCATCGTCCTCCTCCTCCACCTGTTTGGTCGTCTGCAATAAGGCAATTCGGTGCACTAAGATTTTTATCAGTCCACAAAATACTGATCAGTCAGTCAATGAGATTACTCAAATTGATAACAATGACAAGGCAATGACAGAGGAAAACGCGACAACTAATATTGTAACATCCTCATCATCGTCATTGTCCGAGCAACAACAACAACCGGTATCAGAATCATATTCGCCAACAAATTTGTCCGTAGAAATGGAGAATTATAACTTCAATTTCATGTTTGGTCTCGACGTTGACGATCCTTTTCTTTCTGAACTTCTTAGTGTACCTGATTTACGTGACCAAATTTTGGAAAATAGTACTATAAGTAGTACTGTTGATGCTGGTGATGAAGTTGGAGATTGTAATATCTCCGTCAAAAAGGAAAGGCAAAGGAGCTATTTTCCTCCAAGTTCTAGTCAAATTTCAATTTTCTCAGAAGGGACGCAACACAACGATTTGGAACTTTGGATCAATGGGTTCTCTTCTTGTTAA
Protein Sequence:
- >CA00g61780|Capsicum_annuum|MYB|CA00g61780
MGRKPCCSKEGLNKGAWTPIEDKILIDYIKVHGEGKWRNLPNRAGLKRCGKSCRLRWLNYLRPDIKRGNISPDEEDLIIRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNTNIERKLQEAKGSGQPNRVTSSYRQRNRSSHAKSANPSPITQLQQNNQEQTIQQDSNCLLQTDVGREGSSSSSSTCLVVCNKAIRCTKIFISPQNTDQSVNEITQIDNNDKAMTEENATTNIVTSSSSSLSEQQQQPVSESYSPTNLSVEMENYNFNFMFGLDVDDPFLSELLSVPDLRDQILENSTISSTVDAGDEVGDCNISVKKERQRSYFPPSSSQISIFSEGTQHNDLELWINGFSSC*