Information report for BGIOSGA030245-PA
Gene Details
|
|
Functional Annotation
- Refseq: XP_015612590.1 — transcription factor MYB44
- Swissprot: Q9FDW1 — MYB44_ARATH; Transcription factor MYB44
- TrEMBL: A2YYD5 — A2YYD5_ORYSI; Uncharacterized protein
- STRING: ORUFI09G00360.1 — (Oryza rufipogon)
- STRING: OS09T0106700-01 — (Oryza sativa)
- GO:0009414 — Biological Process — response to water deprivation
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009733 — Biological Process — response to auxin
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009739 — Biological Process — response to gibberellin
- GO:0010200 — Biological Process — response to chitin
- GO:0042742 — Biological Process — defense response to bacterium
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0050832 — Biological Process — defense response to fungus
- GO:2000022 — Biological Process — regulation of jasmonic acid mediated signaling pathway
- GO:2000031 — Biological Process — regulation of salicylic acid mediated signaling pathway
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Hordeum vulgare: MLOC_64817.3, MLOC_64817.5, MLOC_64817.4, MLOC_64817.1
- Panicum virgatum: Pavir.2NG248100.1.p
- Setaria viridis: Sevir.2G146600.1.p
- Triticum aestivum: Traes_5DL_92CBBE968.1, Traes_5BL_486D0D865.1
- Zea mays: GRMZM2G050550_P01
Sequences
CDS Sequence:
- >BGIOSGA030245-PA|Oryza_sativa_subsp._indica|MYB|BGIOSGA030245-PA
ATGGCGTCTTGTCGGAGAGGAGGGGGAGGGGATGTGGATAGGATAAAGGGGCCGTGGAGTCCGGAGGAGGACGAGGCGCTGCAGCGGCTGGTGGGGCGGCACGGGGCGCGCAACTGGTCGCTGATAAGCAAGTCCATCCCGGGGAGGTCGGGGAAGTCGTGCCGGCTGCGGTGGTGCAACCAGCTGTCGCCGCAGGTGGAGCACCGGCCCTTCACGCCCGAGGAGGACGACACCATCCTCCGCGCCCACGCCCGCTTCGGCAACAAGTGGGCCACCATCGCCAGGCTCCTCGCCGGCCGCACCGACAACGCCATCAAGAACCACTGGAACTCCACCCTCAAGCGCAAGCACCACTCTTCTCTCCTCGCCGACGACCTCCGCCCTCTCAAGCGGACAACCAGCGACGGCCACCCGACGCTCTCCTCCGCCGCCGCCCCCGGGAGCCCCTCCGGCTCCGACCTCAGCGACTCCAGCCACCATAGCCTCCCCTCCCAGATGCCCTCCTCACCCCCACACCTCCTCCTCCCTCAGCACGTCTACCGCCCGGTCGCGAGGGCCGGCGGGGTCGTCGTCCCTCTTCCTCCTCCCCCGCCGCCTCCGGCGACCTCGCTCTCCCTCTCTCTCTCCCTTCCCGGCCTGGATCACCCACACCCCGATCCCTCCACCCCGTCGGAGCCTGCGGTACAGTTGCAGCCGCCTCCACCGTCTCAGATGCCGCCACCAACACCATCTTGTGTACGCCAAGAGCCGCCTCAGATGCCGTTCCAGCTGCAGCCCCCACCGCCGCCGCGCCCATCGGCGCCGTTCAGCGCGGAGTTCTTGGCCATGATGCAGGAGATGATCCGGATCGAGGTCCGGAATTACATGTCCGGCTCCGCCGCCGTGGATCCCCGGTCGTCGCCCGACAACGGCGTGCGCGCCGCCAGCCGCATCATGGGCATGGCCAAGATCGAGTAA
Protein Sequence:
- >BGIOSGA030245-PA|Oryza_sativa_subsp._indica|MYB|BGIOSGA030245-PA
MASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKHHSSLLADDLRPLKRTTSDGHPTLSSAAAPGSPSGSDLSDSSHHSLPSQMPSSPPHLLLPQHVYRPVARAGGVVVPLPPPPPPPATSLSLSLSLPGLDHPHPDPSTPSEPAVQLQPPPPSQMPPPTPSCVRQEPPQMPFQLQPPPPPRPSAPFSAEFLAMMQEMIRIEVRNYMSGSAAVDPRSSPDNGVRAASRIMGMAKIE