Information report for AHYPO_004571-RA
Gene Details
|
|
Functional Annotation
- Refseq: XP_010666224.1 — PREDICTED: myb-like protein A
- TrEMBL: A0A0J8B4X5 — A0A0J8B4X5_BETVU; Uncharacterized protein
- STRING: XP_010666224.1 — (Beta vulgaris)
- GO:0009555 — Biological Process — pollen development
- GO:0009789 — Biological Process — positive regulation of abscisic acid-activated signaling pathway
- GO:0043068 — Biological Process — positive regulation of programmed cell death
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0090406 — Cellular Component — pollen tube
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Actinidia chinensis: Achn384891
- Beta vulgaris: Bv_000790_ezhe.t1
- Nicotiana tabacum: XP_016506786.1
- Prunus mume: XP_008226955.1
- Prunus persica: Prupe.4G215500.2.p
- Sesamum indicum: XP_011091874.1, XP_011091873.1, XP_011091872.1, XP_011091870.1, XP_011091869.1
- Solanum lycopersicum: Solyc07g052300.2.1
- Solanum melongena: Sme2.5_00128.1_g00007.1, Sme2.5_01766.1_g00003.1
- Solanum tuberosum: PGSC0003DMP400050448
- Vitis vinifera: GSVIVT01037667001
- Ziziphus jujuba: XP_015876156.1, XP_015876155.1, XP_015876154.1, XP_015876153.1
Sequences
CDS Sequence:
- >AHYPO_004571-RA|Amaranthus_hypochondriacus|MYB|AHYPO_004571-RA
ATGATAATGAGCAAGAGTACTGGAGGAGCAGGGAGACAAGAAATGAGGATAGAATCGAACGGTGGAGGATTAAAGAAAGGGCCATGGTCATCATCAGAAGATGCTGTATTGATTGATTATGTGAATAAACATGGAGAAGGGAATTGGAATGCAGTACAGAGGAATACTGGTCTTTTAAGATGTGGGAAAAGTTGTAGATTAAGATGGGCTAATCATCTTCGTCCAAATTTAAAAAAAGGAGCATTTTCTTCTGATGAAGAACGTTTAATCATTGATCTTCATGCTAAACTTGGTAACAAATGGGCTCGCATTTCTGCTCATTTACCTGGCAGAACGGACAATGAAATCAAGAATTATTGGAACACAAGGGTAAAGAGAAGAATTAGACAAGGTTTATCACTTTACCCAAATGATCCTCCAAATCCAACACCATCTCTTTCTCTTCCTAAAAACCCACCACAAACTCTTTCTCTATTCAATCCAATGTCTCTTCCTTCCCCAATTTTCCCTCTTCACAATCCACCACCTCCATTTCTCCCATTCCATCACCCCCTTAAACAAAACTCATTCATGGGTAACCCTAATTTTCCCCCTTCTGAAATGGGTTCATTTCAAATGAACTCAATCGGGTTTGGATTACAGTCTGGTCAGAAAATGGATTTTGATCAGGGTTTTGGATTGGGTAACCCTAGTTTTGAGCTCCCTTCAAACCAATATAACCAAAATGTGGGTGGTAATTATGATCATCTAGAAATGGAAGATGAGATGATAAAGGATAATCTAAATATGGGTATTAGGACTAATAGTGGGTTATTGGATGATCTTCTAATTGAAGCTCAAAAAAAGGTGTGTGTAAAGAGAGAAACAGATCATGATTTTGCTCTTCATTGGGATGTTTCCAGCTCTGAGAATTCTTGCACTGGAATGAAAGATCAATCAGAAGAAGAAGTAAAGTATGATTATCAAGATATTCACAACCCACAACTTCCATCTTTTGATTATGATGCTGATTGGAATCCTGGATGCTATAATTGGGATAATTTGCCTAAAATATATTGA
Protein Sequence:
- >AHYPO_004571-RA|Amaranthus_hypochondriacus|MYB|AHYPO_004571-RA
MIMSKSTGGAGRQEMRIESNGGGLKKGPWSSSEDAVLIDYVNKHGEGNWNAVQRNTGLLRCGKSCRLRWANHLRPNLKKGAFSSDEERLIIDLHAKLGNKWARISAHLPGRTDNEIKNYWNTRVKRRIRQGLSLYPNDPPNPTPSLSLPKNPPQTLSLFNPMSLPSPIFPLHNPPPPFLPFHHPLKQNSFMGNPNFPPSEMGSFQMNSIGFGLQSGQKMDFDQGFGLGNPSFELPSNQYNQNVGGNYDHLEMEDEMIKDNLNMGIRTNSGLLDDLLIEAQKKVCVKRETDHDFALHWDVSSSENSCTGMKDQSEEEVKYDYQDIHNPQLPSFDYDADWNPGCYNWDNLPKIY*