Information report for 678467655
Gene Details
Functional Annotation
- Refseq: XP_022731077.1 — transcription factor MYB36-like
- Swissprot: Q9FKL2 — MYB36_ARATH; Transcription factor MYB36
- TrEMBL: A0A2H5P7S3 — A0A2H5P7S3_CITUN; Uncharacterized protein
- STRING: XP_006474624.1 — (Citrus sinensis)
- STRING: XP_006453430.1 — (Citrus clementina)
- GO:0008285 — Biological Process — negative regulation of cell proliferation
- GO:0035987 — Biological Process — endodermal cell differentiation
- GO:0045597 — Biological Process — positive regulation of cell differentiation
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:2000021 — Biological Process — regulation of ion homeostasis
- GO:2000067 — Biological Process — regulation of root morphogenesis
- GO:0048226 — Cellular Component — Casparian strip
- GO:0000975 — Molecular Function — regulatory region DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_03613
- Citrus sinensis: orange1.1g017727m
- Daucus carota: DCAR_014707
- Glycine max: Glyma.17G065800.1.p, Glyma.13G094400.1.p
- Lotus japonicus: Lj4g3v2079370.1
- Populus trichocarpa: Potri.006G170800.1
- Prunus mume: XP_008223663.1
- Prunus persica: Prupe.1G089700.1.p
- Salvia miltiorrhiza: SMil_00002232-RA_Salv
- Sesamum indicum: XP_011079436.1, XP_011070175.1
- Ziziphus jujuba: XP_015876104.1
Sequences
CDS Sequence:
- >678467655|Utricularia_gibba|MYB|678467655
ATGGGAAGAGCGCCTTGCTGTGACAAAGATAATGTGAAGAAGGGGCCATGGTCTCCAGAGGAGGACGCTAAGCTCAAGGAGCATATAGAGAAATATGGCACTGGCGGCAATTGGATTGCTCTTCCTGCAAAAATAGGGTTGAAGAGATGTGGGAAGAGCTGTCGGCTTAGATGGCTTAACTACCTGAGACCTAATATAAAGCATGGTGGGTTTACTGAAGAAGAAGATGGTATCATTTCAAGCTTATACATCAGTATTGGAAGCAGGTGGTCGATCATCGCGGCTCAGCTTCCGGGAAGAACAGACAACGATGTCAAGAACTACTGGAACACGAGGCTAAAGAAAAAATTGCTTGGACAGCGACGACAAGCGTCGGTATCAACCAATGGAGGAGTAGGAGGAGAAGAAGACAATAGCAGTTTGAGCAACTCAGCTATGGAGAGGCTTCAGCTTCACATGCAGCTCCAAAGCAACGATCCTCTACCAATGTGCGACTGGCCTAAGCCGAAGCCAATGCTGCCAAAGTTTTACGGCCATGATCAATTTAAAGATCCAACGCCCCACAATCTTCCAAATGTCGATGATCAGCCTAATCCAGGGTTTATCCAAAGTGACATTCACGACCTACTGGACTACAGCTTTGGTAGCACGGAGATGGTGATGCCAGGAAACGATAGGATTGACGAAACAGATGGATCGAATGAGGAGTTGGGGTACTGGTCCGCCGAATTGGGGACCAACTGCTCGTTCTTGGACTCGCATTCGGTTCATCAGTCGGATGAAATCTTTCTCATGGAATACGGTATGCAGCAGTAA
Protein Sequence:
- >678467655|Utricularia_gibba|MYB|678467655
MGRAPCCDKDNVKKGPWSPEEDAKLKEHIEKYGTGGNWIALPAKIGLKRCGKSCRLRWLNYLRPNIKHGGFTEEEDGIISSLYISIGSRWSIIAAQLPGRTDNDVKNYWNTRLKKKLLGQRRQASVSTNGGVGGEEDNSSLSNSAMERLQLHMQLQSNDPLPMCDWPKPKPMLPKFYGHDQFKDPTPHNLPNVDDQPNPGFIQSDIHDLLDYSFGSTEMVMPGNDRIDETDGSNEELGYWSAELGTNCSFLDSHSVHQSDEIFLMEYGMQQ