Information report for 678467245
Gene Details
Functional Annotation
- Refseq: XP_012851720.1 — PREDICTED: transcription factor MYB44-like
- Swissprot: O23160 — MYB73_ARATH; Transcription factor MYB73
- TrEMBL: A0A059PRP0 — A0A059PRP0_SALMI; MYB-related transcription factor
- STRING: Migut.C00524.1.p — (Erythranthe guttata)
- GO:0009723 — Biological Process — response to ethylene
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010200 — Biological Process — response to chitin
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0044212 — Molecular Function — transcription regulatory region DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Capsicum annuum: CA00g75700
- Manihot esculenta: Manes.18G042000.1.p
- Medicago truncatula: Medtr5g016510.1
- Nicotiana benthamiana: Niben101Scf00292g02001.1
- Nicotiana tabacum: XP_016438981.1
- Populus trichocarpa: Potri.002G122600.1, Potri.014G022500.1
- Prunus mume: XP_008220277.1
- Prunus persica: Prupe.1G430000.1.p
- Salvia miltiorrhiza: SMil_00013392-RA_Salv, SMil_00017960-RA_Salv
- Sesamum indicum: XP_011074411.1
- Solanum lycopersicum: Solyc04g078420.1.1
- Solanum melongena: Sme2.5_00038.1_g00005.1
- Solanum tuberosum: PGSC0003DMP400005949
- Ziziphus jujuba: XP_015884347.1
Sequences
CDS Sequence:
- >678467245|Utricularia_gibba|MYB|678467245
ATGGCGGCTAGAAGCGAATCTGATCGGATAAAGGGGCCGTGGAGCCCTGAGGAGGACGAGTTGCTGCAGAAATTGGTTGAGAAGCACGGCGCGAGGAACTGGTCGCTGATTAGCAAGTCGATTCCGGGTCGGTCAGGCAAGTCCTGCCGCCTCAGGTGGTGTAACCAGCTGTCGCCGCAGGTGGAGCACCGCGCCTTCACGGTGGAGGAGGATGAGACCATCATACGGGCGCACGCCAGGTTTGGGAACAAATGGGCCACGATCGCGCGGCTTCTCTCCGGCCGTACGGATAACGCTATCAAGAACCACTGGAACTCCACGCTGAAGCGCAAGTGTGTGTCGATGTCTGCGGAAGAGTTCAAGAGCTTCGATCCCGACGCTCAGCCCCCACCTCCGCGGAAGAGATCGGCGAGCGTCGGACCCGGCACCTCCGTTTCCCCGTCGTTCAACGCGGGTAGTCCCACGGGGTCCGACATCAGTGACTCTACCCATTCGGGTCATCTCGTTTACGGACCCGTCCCAACTCTCATAACCCCTTCACAACCCATCCCCGCGCCTGACCCGGTTACTTCACTTTCCCTTTCGTTACCCGGATCCGAAACCAAATCCCCGGATTCCATCCAGATGCCTGCGCCAAAACCCCCCGTCCCCTCAATAATGATCCCATCTCACCCTCCTCCTCCGCCGCAGCTCTTCTGCCCGGAGATTTTAGCGGTGATGCAGGAAATGGTGAGGAAGGAGGTGAGGAATTACATGGCGGGCATGGAGCAAAACGGGTTCTGCCTTCAGACGGATCCCCCCAGAAATGCGGTGATCAAGCGAATGGGCATAAGCAAAATCGATTGA
Protein Sequence:
- >678467245|Utricularia_gibba|MYB|678467245
MAARSESDRIKGPWSPEEDELLQKLVEKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTVEEDETIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCVSMSAEEFKSFDPDAQPPPPRKRSASVGPGTSVSPSFNAGSPTGSDISDSTHSGHLVYGPVPTLITPSQPIPAPDPVTSLSLSLPGSETKSPDSIQMPAPKPPVPSIMIPSHPPPPPQLFCPEILAVMQEMVRKEVRNYMAGMEQNGFCLQTDPPRNAVIKRMGISKID