Information report for 315039
Gene Details
Functional Annotation
- Refseq: XP_002886375.1 — transcription factor MYB26
- Swissprot: Q8VZQ2 — MYB61_ARATH; Transcription factor MYB61
- TrEMBL: D7KSX9 — D7KSX9_ARALL; ATMYB103
- STRING: fgenesh1_pm.C_scaffold_2000072 — (Arabidopsis lyrata)
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:1901430 — Biological Process — positive regulation of syringal lignin biosynthetic process
- GO:2000652 — Biological Process — regulation of secondary cell wall biogenesis
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Arabidopsis thaliana: AT1G63910.1
- Brassica napus: GSBRNA2T00032800001, GSBRNA2T00000047001, GSBRNA2T00065538001, GSBRNA2T00056449001
- Brassica oleracea: XP_013610297.1, XP_013609805.1
- Brassica rapa: XP_009112787.1, XP_009112912.1
- Manihot esculenta: Manes.01G057200.1.p
- Populus trichocarpa: Potri.003G132000.1, Potri.001G099800.1, Potri.003G132000.3, Potri.003G132000.2
- Raphanus raphanistrum: RrC1026_p5
Sequences
CDS Sequence:
- >315039|Arabidopsis_lyrata|MYB|315039
ATGGGTCATCACTCATGCTGCAACCAGCAAAAGGTGAAGAGAGGGCTTTGGTCACCAGAAGAAGATGAGAAGCTTATTAGATATATCACAACTCATGGCTATGGATGTTGGAGTGAAGTCCCTGAAAAAGCAGGGCTTCAAAGATGTGGAAAAAGTTGTAGATTGCGATGGATAAACTATCTTCGACCTGATATCAGAAGAGGAAGGTTCTCTCCAGAAGAAGAGAAATTGATCATAAGTCTTCATGGAGTTGTGGGAAACAGGTGGGCTCATATAGCTAGTCATTTACCCGGACGAACGGATAACGAGATAAAAAACTATTGGAATTCATGGATTAAGAAAAAGATACGAAAACCGCACCACCATTACAATCGTCATCAACCGTCAATAACTACTGTGACAATGAACGTGGACGATGCACCTATTGCCACTACCGTTACCTCTACCACTAATCCATCCACTATTGATAACCTACATTTTGATGGTTTCATGGATTCTGTAAACCAGTTAAATTTCGCCAACGATCAAGAAACTAATATAAAGATTCAAGAAACCCTTTTCTCCCATAAACCTCCTCTCTTCATGGTGGACACAGCGCTTCCTATCCTAGAAGGAATGTTCTCTCAAAACATCATCACAAACAATAACAACAAAAACAACAATCATGACACGCAAAGAGGAGGAAGAGGAAACATTTGCGAACAAGCATTTCTAACAACTAGCACAGAAGAATGGGATATGAATCTTCCTCAACAAGAACAACGAGAACCGTTTCAAGTTCCTACAATGGCGTCCCATTTGTTCAATAACTCTACCAATTCAAATATCGAGACAACTATAAGTTATAATCCACCGGCGATACTAGAGGAAAATGTGGATAACATTGTCCCAATTGAAAATAGCAATGTCCAAGATGGATATATGGCATCAAGTTTCGAATGTTTAAAGAGGCAAGACCTAAGCTATGATCAATGGGTAGATTCACAACAATGCTCTAACTTTTTCTTCTGGGACAACCTTAACATAAACATGGACGGTTCATCTCTTCTTGGAAACCAAGATTCATCAATGACCTTGGGATCATCTGCCTTATCTTCATCTTTTCCGTCTCCATTTTAA
Protein Sequence:
- >315039|Arabidopsis_lyrata|MYB|315039
MGHHSCCNQQKVKRGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYLRPDIRRGRFSPEEEKLIISLHGVVGNRWAHIASHLPGRTDNEIKNYWNSWIKKKIRKPHHHYNRHQPSITTVTMNVDDAPIATTVTSTTNPSTIDNLHFDGFMDSVNQLNFANDQETNIKIQETLFSHKPPLFMVDTALPILEGMFSQNIITNNNNKNNNHDTQRGGRGNICEQAFLTTSTEEWDMNLPQQEQREPFQVPTMASHLFNNSTNSNIETTISYNPPAILEENVDNIVPIENSNVQDGYMASSFECLKRQDLSYDQWVDSQQCSNFFFWDNLNINMDGSSLLGNQDSSMTLGSSALSSSFPSPF*