Information report for BGIOSGA010175-PA
Gene Details
|
|
Functional Annotation
- Refseq: XP_015628086.1 — protein LOL3
- Swissprot: Q6ASS2 — LOL3_ORYSJ; Protein LOL3
- TrEMBL: B8AN39 — B8AN39_ORYSI; Uncharacterized protein
- TrEMBL: I1PDS8 — I1PDS8_ORYGL; Uncharacterized protein
- STRING: OS03T0639600-01 — (Oryza sativa)
- STRING: ORGLA03G0252400.1 — (Oryza glaberrima)
- GO:0000303 — Biological Process — response to superoxide
- GO:0001666 — Biological Process — response to hypoxia
- GO:0002240 — Biological Process — response to molecule of oomycetes origin
- GO:0009626 — Biological Process — plant-type hypersensitive response
- GO:0009862 — Biological Process — systemic acquired resistance, salicylic acid mediated signaling pathway
- GO:0010104 — Biological Process — regulation of ethylene-activated signaling pathway
- GO:0010310 — Biological Process — regulation of hydrogen peroxide metabolic process
- GO:0010602 — Biological Process — regulation of 1-aminocyclopropane-1-carboxylate metabolic process
- GO:0010618 — Biological Process — aerenchyma formation
- GO:0043069 — Biological Process — negative regulation of programmed cell death
Family Introduction
- Arabidopsis lsd1 mutants are hyperresponsive to cell death initiators and fail to limit the extent of cell death. Superoxide is a necessary and sufficient signal for cell death propagation. Thus, LSD1 monitors a superoxide-dependent signal and negatively regulates a plant cell death pathway. We isolated LSD1 via its map position. The predicted LSD1 protein contains three zinc finger domains, defined by CxxCxRxxLMYxxGASxVxCxxC. These domains are present in three additional Arabidopsis genes, suggesting that LSD1 defines a zinc finger protein subclass. LSD1 is constitutively expressed, consistent with the mutant phenotype. Alternate splicing gives rise to a low abundance mRNA encoding an extra five amino-terminal amino acids. We propose that LSD1 regulates transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death.
- The most familiar form of plant programmed cell death is the hypersensitive response (HR) associated with successful plant immune responses. HR is preceded by an oxidative burst and the generation of both reactive oxygen intermediates (ROI) and NO. The Arabidopsis LSD1 gene encodes a negative regulator of plant programmed cell death that meets several criteria for a regulator of processes relevant to ROI management during pathogen responses. Here we demonstrate that a highly conserved LSD1 paralogue, LOL1, acts as a positive regulator of cell death. Manipulation of LOL1 expression alters both the superoxide-dependent, runaway cell death phenotype of lsd1 plants and the normal HR. We also show that LSD1 and LOL1 have antagonistic effects on copper-zinc superoxide dismutase accumulation, consistent with functions in cell death control via maintenance of ROI homeostasis.
Literature and News
- A novel zinc finger protein is encoded by the Arabidopsis LSD1 gene and functions as a negative regulator of plant cell death. DOI: 10.1016/s0092-8674(00)81911-x ; PMID: 9054508
- Antagonistic control of oxidative stress-induced cell death in Arabidopsis by two related, plant-specific zinc finger proteins. DOI: 10.1073/pnas.1130421100 ; PMID: 12732715
Homologs
- Brachypodium distachyon: Bradi1g13971.2.p
- Oryza sativa: OsLSD2
- Panicum virgatum: Pavir.9NG189700.1.p, Pavir.9KG075900.1.p, Pavir.3KG535400.3.p, Pavir.3KG535400.2.p
- Setaria italica: Seita.9G159900.1.p
- Setaria viridis: Sevir.9G158300.1.p
- Triticum aestivum: Traes_5DL_898B0A5A7.1, Traes_5BL_4E60DC151.1
Sequences
CDS Sequence:
- >BGIOSGA010175-PA|Oryza_sativa_subsp._indica|LSD|BGIOSGA010175-PA
ATGCAGAGCCAGATCGTGTGCCATGGCTGCCGGAGCGTGCTGCGGTACCCGAGCGGGGCGCCCAGCGTGTGCTGCGCGCTCTGCCAGGCCATCACCACCGTGCCGCCCCCTGCCCCAGTAATGGAAATGGCTCATCTAATATGTGGTGGTTGCCGAACATTGCTGATGTATACTCGCAATGCGGACACTGTGAGATGTTCATGTTGCAGTACAGTCAATCTTGTTAGACCAGTGAATAATATAGCACATGTGAGCTGTGGCCAGTGCCGGACGACTTTGATGTATCCATATGGCGCACCTTCTGTCAAATGTGCCATATGCCATTATATCACAAACACCGGAATGAATACTGTGGCACCCACGCCATCTCCAATGCCTACATCAAGTGGATCTTCATATAATGCCCCCCCAAGTGGATCTTCATATAATGCCCCCCCACCAACTTCAGCTCCCACATCTCGACCCCAGAATGTAACCGTTGTTGTCGAGAACCCTATGACTGTTGATGAAAAGGGTAAACTGGTTAGCAATGTTGTAGTTGGAGTTACAACTGGGAAATAG
Protein Sequence:
- >BGIOSGA010175-PA|Oryza_sativa_subsp._indica|LSD|BGIOSGA010175-PA
MQSQIVCHGCRSVLRYPSGAPSVCCALCQAITTVPPPAPVMEMAHLICGGCRTLLMYTRNADTVRCSCCSTVNLVRPVNNIAHVSCGQCRTTLMYPYGAPSVKCAICHYITNTGMNTVAPTPSPMPTSSGSSYNAPPSGSSYNAPPPTSAPTSRPQNVTVVVENPMTVDEKGKLVSNVVVGVTTGK