Gene Details:
- Gene ID: Thhalv10003411m
- Gene Name: EUTSA_v10003411mg
- Gene Family: HSF Family
- Description: HSF Family protein
- Species: Eutrema salsugineum
- Source: HSF family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:2.60.120.10
- SuperFamily: SSF51182
- Pfam: PF03079
- SMART: SM00415
- Gene3D: G3DSA:1.10.10.10
- SuperFamily: SSF46785
- Pfam: PF00447
- PRINTS: PR00056
- PROSITE pattern: PS00434
- InterPro: IPR014710 IPR027496 IPR011051 IPR004313 IPR000232 IPR011991
Annotation Proteins:
- Refseq: XP_002867928.1 — heat stress transcription factor A-4a
- TrEMBL: V4NF68 — V4NF68_EUTSA; Uncharacterized protein
- STRING: XP_006403293.1 — (Eutrema salsugineum)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction:
- Heat stress transcription factors (Hsfs) are the major regulators of the plant heat stress (hs) response. Sequencing of the Arabidopsis genome revealed the existence of 21 open-reading frames (ORFs) encoding putative Hsfs assigned to classes A-C. Here we present results of a functional genomics approach to the Arabidopsis Hsf family focused on the analysis of their C-terminal domains (CTDs) harboring conserved modules for their function as transcription factors and their intracellular localization. Using reporter assays in tobacco protoplasts and yeast as well as glutathione-S-transferase (GST) pull-down assays, we demonstrate that short peptide motifs enriched with aromatic and large hydrophobic amino acid (aa) residues embedded in an acidic surrounding (AHA motifs) are essential for transcriptional activity of class A Hsfs. In contrast to this, class B and C Hsfs lack AHA motifs and have no activator function on their own. We also provide evidence for the function of a leucine (Leu)-rich region centered around a conserved QMGΦL motif at the very C-terminus as a nuclear export signal (NES) of class A Hsfs. Sequence comparison indicates that the combination of a C-terminal AHA motif with the consensus sequence FWxxF/L,F/I/L as well as the adjacent NES represents a signature domain for plant class A Hsfs, which allowed to identify more than 60 new Hsfs from the expressed sequence tag (EST) database.
Literature:
- Characterization of C-terminal domains of Arabidopsis heat stress transcription factors (Hsfs) and identification of a new signature combination of plant class A Hsfs with AHA and NES motifs essential for activator function and intracellular localization. DOI: 10.1111/j.1365-313X.2004.02111.x ; PMID: 15200645
Sequences:
CDS Sequence:
- >Thhalv10003411m|Eutrema_salsugineum|HSF|Thhalv10003411m
ATGGTGAAGTATAAATTTCCAAAGGGAATTCTGAGTATCTTCAAGCTTCTATATACGGTTGTGGATGATCCATCACTGGATTCAATAATCTCATGGAGCAACAGCAACAAGAGTTTCGTCATCTGGAATCCGGAAGAGCTACATCAGAGAAAGATATTTGAGAGCCACTATTATGGCTGCGAGTTCCCAGAATTCTTGGCCGTGCTTAAGACTTATGGCTTTGAAAGAGTTAAGGGTGCTGGGCGATTGGAATTTGCAAATGCAAATTTTGTGAGGGGTCAACCTAAGCTTTTGGGGAAGTTGCAGTCCAAGGCTTGGGCAAATATGAGGAAGAGATTCCGAGCAAGAATGGAAGATGAAAGAAAAACACACCAACCAGCGAATGCGTTGGAACATTTACGAATTTGA
Protein Sequence:
- >Thhalv10003411m|Eutrema_salsugineum|HSF|Thhalv10003411m
MVKYKFPKGILSIFKLLYTVVDDPSLDSIISWSNSNKSFVIWNPEELHQRKIFESHYYGCEFPEFLAVLKTYGFERVKGAGRLEFANANFVRGQPKLLGKLQSKAWANMRKRFRARMEDERKTHQPANALEHLRI*