Information report for Gh_D11G0093
Gene Details
|
|
Functional Annotation
- Refseq: NP_001313865.1 — heat stress transcription factor B-2a-like
- Swissprot: Q9SCW4 — HFB2A_ARATH; Heat stress transcription factor B-2a
- TrEMBL: A0A1U8JE57 — A0A1U8JE57_GOSHI; heat stress transcription factor B-2a-like
- STRING: Gorai.007G010900.1 — (Gossypium raimondii)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0010200 — Biological Process — response to chitin
- GO:0005634 — Cellular Component — nucleus
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction
- Heat stress transcription factors (Hsfs) are the major regulators of the plant heat stress (hs) response. Sequencing of the Arabidopsis genome revealed the existence of 21 open-reading frames (ORFs) encoding putative Hsfs assigned to classes A-C. Here we present results of a functional genomics approach to the Arabidopsis Hsf family focused on the analysis of their C-terminal domains (CTDs) harboring conserved modules for their function as transcription factors and their intracellular localization. Using reporter assays in tobacco protoplasts and yeast as well as glutathione-S-transferase (GST) pull-down assays, we demonstrate that short peptide motifs enriched with aromatic and large hydrophobic amino acid (aa) residues embedded in an acidic surrounding (AHA motifs) are essential for transcriptional activity of class A Hsfs. In contrast to this, class B and C Hsfs lack AHA motifs and have no activator function on their own. We also provide evidence for the function of a leucine (Leu)-rich region centered around a conserved QMGΦL motif at the very C-terminus as a nuclear export signal (NES) of class A Hsfs. Sequence comparison indicates that the combination of a C-terminal AHA motif with the consensus sequence FWxxF/L,F/I/L as well as the adjacent NES represents a signature domain for plant class A Hsfs, which allowed to identify more than 60 new Hsfs from the expressed sequence tag (EST) database.
Literature and News
- Characterization of C-terminal domains of Arabidopsis heat stress transcription factors (Hsfs) and identification of a new signature combination of plant class A Hsfs with AHA and NES motifs essential for activator function and intracellular localization. DOI: 10.1111/j.1365-313X.2004.02111.x ; PMID: 15200645
Gene Resources
Homologs
- Cicer arietinum: XP_004515711.1
- Citrus sinensis: orange1.1g020146m
- Glycine max: Glyma.20G156800.1.p, Glyma.09G143200.1.p
- Gossypium arboreum: Cotton_A_07539_BGI-A2_v1.0
- Juglans regia: WALNUT_00004368-RA
- Malus domestica: MDP0000260377, MDP0000150429
- Manihot esculenta: Manes.14G027700.1.p
- Prunus mume: XP_008234272.1
- Prunus persica: Prupe.2G292100.1.p
- Pyrus bretschneideri: Pbr013953.1
- Ricinus communis: 30147.m014282
- Sesamum indicum: XP_011076202.1, XP_011076201.1
Sequences
CDS Sequence:
- >Gh_D11G0093|Gossypium_hirsutum|HSF|Gh_D11G0093
ATGGCTCCGCCGCCGGTGGAGCAAAACGGAGATGCAACGACGGGAACGGCGGAATCACAAAGGTCTATTCCGACACCGTTCTTGACTAAAACGTATCAATTGGTTGATGATCACACGATTGACGACGTGATTTCGTGGAACGACGACGGATCTACTTTTATCGTTTGGAATCCCACGGTGTTCGCTCGTGATTTGCTTCCTAAATATTTCAAGCATAACAATTTCTCTAGTTTTGTTCGTCAACTCAATACTTATGGATTTAGAAAAGTGGTGCCCGATCGATGGGAATTCTCTAACGATTATTTTCGACGAGGTGAAAAGCGACTTTTGTGCGAAATCCAGCGACGGAAGATCTCGTCGCCAACAGCAGCAGCTGTTACGGTGGCTCCGGTGACGGTTGCGGCTATTCCAATGGCGAAGCCTATTATATCACCGTCGAATTCTGGAGACGAGCAATCTCCAGTCATTTCATCGGCCTCATCGCCTTCAAGGCTGAACCAAGCAGGAACCGTTATGGCCGAGCTCATGAAAGAAAACGAAAAATTGAGGAAAGAGAACGTGCAGCTTAACAAACAATTATCAGAGATGAAGAGCTTGTGCAATAATATATTCAGTTTGATGTCGAATTACGCAAGTTCTCAGTCGGAGAACATTTCTCCCGTGCACAAACCGCTAGATTTCTTGCCGGCGAAGCGGTTATCATGGGGAGAATCAGTCAAAGAAGAAACGAGTCCGAGGTTATTCGGCGTTCCAATAGGAGGAGCGGCAAAGCGGGCCAGGGAAGAAGGAGAAGGCGTAGGGACGGAAGCGGCGACGGCAGCAGACGAAACGCAATTACAACTGCAACAGCCCGGTGGAAGTGAGATTATTAAATTAGAGCCGTTGGATTGCCAGAACCGAGGGCGCGATGATGATCGTGGGATTCAAGACGCGCCGTGGCTTCGGCAGGTGCACCGAGCGAATCAAAGGGTTTGTAATTGA
Protein Sequence:
- >Gh_D11G0093|Gossypium_hirsutum|HSF|Gh_D11G0093
MAPPPVEQNGDATTGTAESQRSIPTPFLTKTYQLVDDHTIDDVISWNDDGSTFIVWNPTVFARDLLPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFSNDYFRRGEKRLLCEIQRRKISSPTAAAVTVAPVTVAAIPMAKPIISPSNSGDEQSPVISSASSPSRLNQAGTVMAELMKENEKLRKENVQLNKQLSEMKSLCNNIFSLMSNYASSQSENISPVHKPLDFLPAKRLSWGESVKEETSPRLFGVPIGGAAKRAREEGEGVGTEAATAADETQLQLQQPGGSEIIKLEPLDCQNRGRDDDRGIQDAPWLRQVHRANQRVCN