Information report for EcC054820.260
Gene Details
|
|
Functional Annotation
- Refseq: XP_010060628.1 — PREDICTED: homeobox-leucine zipper protein ATHB-52-like
- STRING: XP_010060628.1 — (Eucalyptus grandis)
- GO:0005975 — Biological Process — carbohydrate metabolic process
- GO:0006108 — Biological Process — malate metabolic process
- GO:0006412 — Biological Process — translation
- GO:0006508 — Biological Process — proteolysis
- GO:0006520 — Biological Process — cellular amino acid metabolic process
- GO:0007264 — Biological Process — small GTPase mediated signal transduction
- GO:0008033 — Biological Process — tRNA processing
- GO:0015074 — Biological Process — DNA integration
- GO:0031936 — Biological Process — negative regulation of chromatin silencing
- GO:0055085 — Biological Process — transmembrane transport
- GO:0055114 — Biological Process — oxidation-reduction process
- GO:0080111 — Biological Process — DNA demethylation
- GO:0005840 — Cellular Component — ribosome
- GO:0009506 — Cellular Component — plasmodesma
- GO:0016021 — Cellular Component — integral component of membrane
- GO:0003682 — Molecular Function — chromatin binding
- GO:0003723 — Molecular Function — RNA binding
- GO:0003735 — Molecular Function — structural constituent of ribosome
- GO:0004222 — Molecular Function — metalloendopeptidase activity
- GO:0005509 — Molecular Function — calcium ion binding
- GO:0005515 — Molecular Function — protein binding
- GO:0005524 — Molecular Function — ATP binding
- GO:0005525 — Molecular Function — GTP binding
- GO:0008270 — Molecular Function — zinc ion binding
- GO:0008483 — Molecular Function — transaminase activity
- GO:0030060 — Molecular Function — L-malate dehydrogenase activity
- GO:0030170 — Molecular Function — pyridoxal phosphate binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction
- A homeobox (HB) encodes a protein domain, the homeodomain (HD), which is a conserved 60-amino acid motif present in transcription factors found in all the eukaryotic organisms. This 60-amino acid sequence folds into a characteristic three-helix structure that is able to interact specifically with DNA. Most HDs are able to bind DNA as monomers with high affinity, through interactions made by helix III (the so-called recognition helix) and a disordered N-terminal arm located beyond helix I. The high degree of conservation of this type of domain among diverse proteins from different kingdoms indicates that this structure is crucial to maintain the HD functionality and that the role played by this domain is vital.
- Members of the HD-Zip family have a leucine zipper motif (LZ) immediately downstream of the HD. The two motifs are present in transcription factors found in species belonging to other eukaryotic kingdoms, but their association in a single protein is unique to plants. The HD is responsible for the specific binding to DNA, whereas LZ acts as a dimerization motif. HD-Zip proteins bind to DNA as dimers, and the absence of LZ absolutely abolishes their binding ability, which indicates that the relative orientation of the monomers, driven by this motif, is crucial for an efficient recognition of DNA.
Literature and News
Gene Resources
Sequences
CDS Sequence:
- >EcC054820.260|Eucalyptus_camaldulensis|HD-ZIP|EcC054820.260
ATGGAATTTTTCCATGCTCAACATCCTCACCCGAAGCCAAAACCGAAGCAGCAACAGCCCTCCTTGTCGCCGTCCAAACGGGTCAGGACAAAGAGGCTCGCTCCCGACCAAGTGAGGCTCCTGGAGCGGAGCTTCGCCTCCCACAAGAAGCTCGACCCGGACCGCAAGCTCCAGCTCGCGGCCGAGCTAGGCGTCCCGCCTCGGCAGGTCGCCATCTGGTACCAGAACCGGCGCGCCCGATGGCGGACACAGACCCTCGAGCTCGACTGTGGCGCCCTCAAGCTCGAGCTCGACGATGCGCTGGCTGAGAGGCGGAAGCTCGAGCAGGAGGTCGCGTCGCTCCGCCAGGAGCTCGAGAGGGCTTGGGAGATGCTCGACACCGCTTGTGGCAAAGGCCAGAACCACAGAGAGGGCAGCAACGGCGCCGCTCCCGAGGTTCCGACGAGCCGTCTGTGCAATGAGGGCGAGGTGAATTGGTGCCAATGGGACGATGGCAATAAGGTCTTGCCAATGGAGGATGGCGATGACGACGATCTCTATGCCTGTTGGATGTTGACTAATGGCGGGTCGCGCCTGGATTGA
Protein Sequence:
- >EcC054820.260|Eucalyptus_camaldulensis|HD-ZIP|EcC054820.260
MEFFHAQHPHPKPKPKQQQPSLSPSKRVRTKRLAPDQVRLLERSFASHKKLDPDRKLQLAAELGVPPRQVAIWYQNRRARWRTQTLELDCGALKLELDDALAERRKLEQEVASLRQELERAWEMLDTACGKGQNHREGSNGAAPEVPTSRLCNEGEVNWCQWDDGNKVLPMEDGDDDDLYACWMLTNGGSRLD