Information report for CA07g17430
Gene Details
|
|
Functional Annotation
- Refseq: XP_016579531.1 — PREDICTED: E3 SUMO-protein ligase MMS21
- Swissprot: Q8GYH7 — NSE2_ARATH; E3 SUMO-protein ligase MMS21
- TrEMBL: A0A1U8H7Q8 — A0A1U8H7Q8_CAPAN; E3 SUMO-protein ligase MMS21
- STRING: PGSC0003DMT400032388 — (Solanum tuberosum)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0006974 — Biological Process — cellular response to DNA damage stimulus
- GO:0008284 — Biological Process — positive regulation of cell proliferation
- GO:0010082 — Biological Process — regulation of root meristem growth
- GO:0016925 — Biological Process — protein sumoylation
- GO:0032876 — Biological Process — negative regulation of DNA endoreduplication
- GO:0045931 — Biological Process — positive regulation of mitotic cell cycle
- GO:0060250 — Biological Process — germ-line stem-cell niche homeostasis
- GO:0080038 — Biological Process — positive regulation of cytokinin-activated signaling pathway
- GO:0005634 — Cellular Component — nucleus
- GO:0008270 — Molecular Function — zinc ion binding
- GO:0019789 — Molecular Function — SUMO transferase activity
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction
- A homeobox (HB) encodes a protein domain, the homeodomain (HD), which is a conserved 60-amino acid motif present in transcription factors found in all the eukaryotic organisms. This 60-amino acid sequence folds into a characteristic three-helix structure that is able to interact specifically with DNA. Most HDs are able to bind DNA as monomers with high affinity, through interactions made by helix III (the so-called recognition helix) and a disordered N-terminal arm located beyond helix I. The high degree of conservation of this type of domain among diverse proteins from different kingdoms indicates that this structure is crucial to maintain the HD functionality and that the role played by this domain is vital.
- Members of the HD-Zip family have a leucine zipper motif (LZ) immediately downstream of the HD. The two motifs are present in transcription factors found in species belonging to other eukaryotic kingdoms, but their association in a single protein is unique to plants. The HD is responsible for the specific binding to DNA, whereas LZ acts as a dimerization motif. HD-Zip proteins bind to DNA as dimers, and the absence of LZ absolutely abolishes their binding ability, which indicates that the relative orientation of the monomers, driven by this motif, is crucial for an efficient recognition of DNA.
Literature and News
Gene Resources
Homologs
- Arabidopsis thaliana: AT3G15150
- Gossypium arboreum: Cotton_A_06253_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A01G0439
- Malus domestica: MDP0000146339
- Nicotiana benthamiana: Niben101Scf00479g03014.1
- Nicotiana tabacum: XP_016444534.1, XP_016479504.1, XP_016452182.1, XP_016485761.1
- Petunia inflata: Peinf101Scf02138g03014.1
- Prunus persica: Prupe.4G174000.1.p
- Pyrus bretschneideri: Pbr038266.1
- Sesamum indicum: XP_011082709.1
- Solanum lycopersicum: Solyc07g062790.1.1
- Solanum melongena: Sme2.5_01078.1_g00002.1
- Solanum tuberosum: PGSC0003DMP400022005, PGSC0003DMP400036873
- Vitis vinifera: GSVIVT01014276001
Sequences
CDS Sequence:
- >CA07g17430|Capsicum_annuum|HD-ZIP|CA07g17430
ATGAATAGTTCCTTCAATTCTCAAAACTTACAAAAATATCCAAACAAAAAAAGGCTAAATCAAGAACAAGTTAAGCTTCTAGAGGCGAGTTTCGACTCAACTAAAAAACTCGAGCTAGAGAAAAAACTCCAATTGTCAAAAGAATTAGGGGTTCCACCTCGACAAATTTCAATATGGTATCAGAACAGGAGAGCGCGATGGAAGAATCAGAACTTGGAGAATGACTATAATGCCCTTCAACTCAAGCTTGAAAATGCATTATCTGAGAAAATGCAACTTGAAAAAGAAACTGAATTTCTTAGAGGAGAATTGCAAAGAGCAAATGAAATGTTAATTGCAATAAATTCAGGAGCACAAGGGCAAATTAGGGAATTTTCACTATCTAGTTCATGTTGTGATCAAGATGTGGTCAGTTATACTAGTACTACTTGGGTACATACTGATCATGAGGTTAATTATAATTTGCAATTTGATGAACTTTATGCTATGATAGGTGTGGAAGAAGGGTCCAATAAATGTTATTCAACTTGCAAATTAAAACTCAATAATCTCCGTCCAAACGACGCCGTAAAACCCTCAAAATGGCGTCGACGTCCGNNNNNNNNNGGCAGCGGCGGAGTGGCTACCGGAAGAATCAGATCTACGACATCAGCGCTTTACTCCGACAGTCAATCGTTATTGCGTGAAATTAGGAAGTCTATTGCTATGATGAAAGATATCGCGGTTGAATTGGAGAGAGATGAGAGAAAAGAGATGGTAAAAGAGCTTGAAGATGGCGTTGTTCAGTTGTTGGCAGCATCTGATGACTGCATGCATCTCTCCGAGGCAATTCAGTCTATAGGTGATGAAATAGAGCCTGGGCCAGAGCCAACGAATTTTAAGAAGAAGTTTGATGAAGAAATTGCAAAATCAAAGGCTAGATCATCATCTCATGCTCAGAACCAGTCTTTATTGAGACAATTCCGGGAAGCCATCTGGCATGTTCATCATGCTGGACAGCCATTGCCAGGTGATGAGCAGGAGGACATTGTAATGACCAGTACACAATGCAACCTTCTGAATGTGACTTGCCCGTTAAGTGGAAAGCCCGTTACTGAACTTGCTGAACCAGTTCGTAGCATGGACTGCAAGCATATATACGAAAAGAAGACTATTATGCAGTACCTCAAGTCCAAAACCTCACGTGGCCAATGTCCCGTTGCAGGTTGTCCGAAAATTCTGAAGGCACAAAGGGTGTTATGTGACCCTTTCTTACTTATAGAAATTGATGAACTCATGTCCACGAGTAAGCAAAATAGACCTGATGCGATAGAGGATTTCACTGTGCTTGATGACGAGGATTGA
Protein Sequence:
- >CA07g17430|Capsicum_annuum|HD-ZIP|CA07g17430
MNSSFNSQNLQKYPNKKRLNQEQVKLLEASFDSTKKLELEKKLQLSKELGVPPRQISIWYQNRRARWKNQNLENDYNALQLKLENALSEKMQLEKETEFLRGELQRANEMLIAINSGAQGQIREFSLSSSCCDQDVVSYTSTTWVHTDHEVNYNLQFDELYAMIGVEEGSNKCYSTCKLKLNNLRPNDAVKPSKWRRRPXXXGSGGVATGRIRSTTSALYSDSQSLLREIRKSIAMMKDIAVELERDERKEMVKELEDGVVQLLAASDDCMHLSEAIQSIGDEIEPGPEPTNFKKKFDEEIAKSKARSSSHAQNQSLLRQFREAIWHVHHAGQPLPGDEQEDIVMTSTQCNLLNVTCPLSGKPVTELAEPVRSMDCKHIYEKKTIMQYLKSKTSRGQCPVAGCPKILKAQRVLCDPFLLIEIDELMSTSKQNRPDAIEDFTVLDDED*