Gene Details:
- Gene ID: cra_locus_10871_iso_5
- Gene Family: HB-other Family
- Description: HB-other Family protein
- Species: Catharanthus roseus
- Source: HB-other family gene from PlantTFDB
Protein Features:
- SuperFamily: SSF46689
- SMART: SM00389
- Gene3D: G3DSA:1.10.10.60
- PROSITE profile: PS50071
- Pfam: PF00046
- PROSITE pattern: PS00027
- Gene3D: G3DSA:1.20.5.170
- InterPro: IPR009057 IPR001356 IPR017970
Annotation Proteins:
- Refseq: XP_020551126.1 — protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
- Swissprot: Q8H0V5 — OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
- TrEMBL: A0A438KET7 — A0A438KET7_VITVI; Protein overexpressor of cationic peroxidase 3
- STRING: VIT_04s0008g05190.t01 — (Vitis vinifera)
Gene Ontology:
- GO:0002229 — Biological Process — defense response to oomycetes
- GO:0009414 — Biological Process — response to water deprivation
- GO:0009682 — Biological Process — induced systemic resistance
- GO:0009787 — Biological Process — regulation of abscisic acid-activated signaling pathway
- GO:0010118 — Biological Process — stomatal movement
- GO:0050832 — Biological Process — defense response to fungus
- GO:2000022 — Biological Process — regulation of jasmonic acid mediated signaling pathway
- GO:2000071 — Biological Process — regulation of defense response by callose deposition
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A homeobox (HB) encodes a protein domain, the homeodomain (HD), which is a conserved 60-amino acid motif present in transcription factors found in all the eukaryotic organisms. This 60-amino acid sequence folds into a characteristic three-helix structure that is able to interact specifically with DNA. Most HDs are able to bind DNA as monomers with high affinity, through interactions made by helix III (the so-called recognition helix) and a disordered N-terminal arm located beyond helix I. The high degree of conservation of this type of domain among diverse proteins from different kingdoms indicates that this structure is crucial to maintain the HD functionality and that the role played by this domain is vital.
Literature:
Sequences:
CDS Sequence:
- >cra_locus_10871_iso_5|Catharanthus_roseus|HB-other|cra_locus_10871_iso_5
Protein Sequence:
- >cra_locus_10871_iso_5|Catharanthus_roseus|HB-other|cra_locus_10871_iso_5
MSKDAQEDEELDEDAFEALFRQLEEDLKNDGASLDDFDDDDISEENLAKLEKELEEALKDDELLGALGSIEDEKTENEAEDEEEEGEEDENFRTAYEDHNLEEEDDEDNEDDEIPLQLKNWQLKRLAYALKAGRRKTSIKNLAADLCLDRALVLNLLRDPPPNLLMLSAAVPDKPVSTVVEPVKEPAEAISSEAIPAIEKSEAKANMKVPVHVMQRNWSAQKRIKKVQLETLERVYKRTKRPTNAMISSIVHVTNLPRRRVLKWFEDQRAEDGVPERRLPYQRPLLQDP