Gene Details:

  • Gene ID: AT5G11270.1
  • Gene Name: F2I11.160, OCP3
  • Gene Family: HB-other Family
  • Description: HB-other Family protein
  • Species: Arabidopsis thaliana
  • Source: HB-other family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_196688.2  — overexpressor of cationic peroxidase 3
  • Swissprot:  Q8H0V5  — OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
  • TrEMBL:  A0A178UCN6  — A0A178UCN6_ARATH; OCP3
  • STRING:  AT5G11270.1  — (Arabidopsis thaliana)

Gene Ontology:

  • GO:0002229  — Biological Process — defense response to oomycetes
  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0009414  — Biological Process — response to water deprivation
  • GO:0009682  — Biological Process — induced systemic resistance
  • GO:0009787  — Biological Process — regulation of abscisic acid-activated signaling pathway
  • GO:0010118  — Biological Process — stomatal movement
  • GO:0050832  — Biological Process — defense response to fungus
  • GO:0055114  — Biological Process — oxidation-reduction process
  • GO:0098869  — Biological Process — cellular oxidant detoxification
  • GO:2000022  — Biological Process — regulation of jasmonic acid mediated signaling pathway
  • GO:2000071  — Biological Process — regulation of defense response by callose deposition
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0004601  — Molecular Function — peroxidase activity

Family Introduction:

  • A homeobox (HB) encodes a protein domain, the homeodomain (HD), which is a conserved 60-amino acid motif present in transcription factors found in all the eukaryotic organisms. This 60-amino acid sequence folds into a characteristic three-helix structure that is able to interact specifically with DNA. Most HDs are able to bind DNA as monomers with high affinity, through interactions made by helix III (the so-called recognition helix) and a disordered N-terminal arm located beyond helix I. The high degree of conservation of this type of domain among diverse proteins from different kingdoms indicates that this structure is crucial to maintain the HD functionality and that the role played by this domain is vital.

Literature:

Sequences:

CDS Sequence:
  • >AT5G11270.1|Arabidopsis_thaliana|HB-other|AT5G11270.1
    ATGATAAAAGCCATGGCTCTATCTTCTGCCGGCGTCGTCTCTCATCTTCATCCTCCGTCGTTTTCTTCGTCGTCAGGATTATCCGTCAACAGAGTTCTGTTTCGGAATCGGAACGCTAGTCCTTGTGGTCTATCTCTTCCAATTCTCAATCCGTCTCGGTCTGTACTTGTTTTTGCTCGTGGCAAGAATCGAAAAGGATTCGTGTCTTCGTCTTCTTCGTCTCCGAAGAAAAACAAAAAGAAAAGTTTGGATGGAGCTGATAATGGAGGAGGTGAGGAGGAGGAGGATCCATTTGAGGCATTGTTTAATCTTTTAGAAGAAGATTTGAAGAATGATAACTCGGATGATGAGGAGATAAGTGAGGAAGAGTTAGAGGCATTAGCCGATGAGTTAGCTCGAGCATTGGGTGTTGGTGACGATGTTGATGACATCGACTTGTTTGGTTCAGTCACTGGTGATGTTGATGTTGATGTTGATAATGATGATGATGATAATGATGATGATGATAATGATGATGATGATGATGACAGCGAAGAAGATGAAAGACCGACTAAGCTGAAGAATTGGCAGCTTAAAAGACTGGCTTATGCATTGAAAGCTGGGCGTCGTAAAACTAGTATTAAAAATCTGGCAGCTGAGGTTTGTCTTGACAGGGCTTATGTTCTTGAATTGCTTCGTGACCCGCCTCCAAAGCTGCTAATGCTAAGTGCTACACTACCAGATGAAAAACCGCCAGTAGCAGCACCTGAGAACTCCTCACCTGATCCAAGTCCTGTGGAATCATTATCAGCTGAAGATGTTGTGGTCGAACCTAAGGAAAAAGTAAAAGATGAAGCAGTTCATGTGATGCAACAGAGATGGTCTGCTCAGAAAAGAGTGAAGAAAGCTCACATTGAAACGCTAGAGAAAGTTTACAGAAGATCAAAACGACCCACTAATGCTGTGGTTAGCAGCATTGTTCAAGTGACCAATCTTCCAAGGAAGCGAGTTTTGAAGTGGTTCGAAGATAAAAGAGCAGAAGACGGAGTTCCAGATAAGCGAGCTCCATATCAAGCTCCGGTTTGA
Protein Sequence:
  • >AT5G11270.1|Arabidopsis_thaliana|HB-other|AT5G11270.1
    MIKAMALSSAGVVSHLHPPSFSSSSGLSVNRVLFRNRNASPCGLSLPILNPSRSVLVFARGKNRKGFVSSSSSSPKKNKKKSLDGADNGGGEEEEDPFEALFNLLEEDLKNDNSDDEEISEEELEALADELARALGVGDDVDDIDLFGSVTGDVDVDVDNDDDDNDDDDNDDDDDDSEEDERPTKLKNWQLKRLAYALKAGRRKTSIKNLAAEVCLDRAYVLELLRDPPPKLLMLSATLPDEKPPVAAPENSSPDPSPVESLSAEDVVVEPKEKVKDEAVHVMQQRWSAQKRVKKAHIETLEKVYRRSKRPTNAVVSSIVQVTNLPRKRVLKWFEDKRAEDGVPDKRAPYQAPV