Gene Details:

  • Gene ID: Potri.003G118100.1
  • Gene Name: POPTR_0003s11800g
  • Gene Family: GRF Family
  • Description: GRF Family protein
  • Species: Populus trichocarpa
  • Source: GRF family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006385746.1  — growth-regulating factor 10 isoform X1
  • Swissprot:  Q6AWX7  — GRF12_ORYSJ; Growth-regulating factor 12
  • TrEMBL:  U5GJ98  — U5GJ98_POPTR; Uncharacterized protein
  • STRING:  POPTR_0003s11800.1  — (Populus trichocarpa)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0005524  — Molecular Function — ATP binding

Family Introduction:

  • Previously, we identified a novel rice gene, GROWTH-REGULATING FACTOR1 (OsGRF1), which encodes a putative transcription factor that appears to play a regulatory role in stem elongation. We now describe the GRF gene family of Arabidopsis thaliana (AtGRF), which comprises nine members.
  • The deduced AtGRF proteins contain the same characteristic regions–the QLQ (Gln, Leu, Gln) and WRC (Trp, Arg, Cys) domains–as do OsGRF1 and related proteins in rice, as well as features indicating a function in transcriptional regulation. Most of the AtGRF genes are strongly expressed in actively growing and developing tissues, such as shoot tips, flower buds, and roots, but weakly in mature stem and leaf tissues.
  • Overexpression of AtGRF1 and AtGRF2 resulted in larger leaves and cotyledons, as well as in delayed bolting of the inflorescence stem when compared to wild-type plants. In contrast, triple insertional null mutants of AtGRF1-AtGRF3 had smaller leaves and cotyledons, whereas single mutants displayed no changes in phenotype and double mutants displayed only minor ones. The alteration of leaf growth in overexpressors and triple mutants was based on an increase or decrease in cell size, respectively. These results indicate that AtGRF proteins play a role in the regulation of cell expansion in leaf and cotyledon tissues.

Literature:

Sequences:

CDS Sequence:
  • >Potri.003G118100.1|Populus_trichocarpa|GRF|Potri.003G118100.1
    ATGGAGTCTCAAGCCCCACCTCCCAAATTTGCCCGTCTTTCAAACTCTAGGACTAGGCTTGCAAGTGGTTGGAACGTGGAGAGAAATAGGCGCGATGGTGAATCTGGGTCACCTCCAATTGGGCTAGGACTTGAACTTGGACGCGGTGGGTCTAGTCAAAGACCAATAATCAGCTGCAAAAAACCTTATGGGTTCACCGTTCTTCAACTGCAGGAGCTACAACTCCAGTCTCTTATCTATACGTATATCCAAGCTGGATTTCCTGTACCTTACCACCTTGTTTTACCTATATGGAGAAGTGTTGCTACTTCCCTTGGTGGTCTCAGTTCAAGGTTGTACCAACTCTACCCTAGTCTTATGGGGTGCAACCCATTATACTTGGCATATAAGAATGGAATGGACCCTGAACCAGGGAGATGTAGGAGAACAGATGGAAAGAAATGGAGGTGTAGCAAAGAGGCTCTCCCATATCAAAAGTACTGTGACAGGCACATACACAGAGGACGCCAGCGTTCAAGAAAGCTTGAGGAATCTGCTTCCCATGGTAATTCCAGCACAGACCTCTCCATTTCCCTCCCCGCTGGAATCAGTGGTGCTAGCGCCTAG
Protein Sequence:
  • >Potri.003G118100.1|Populus_trichocarpa|GRF|Potri.003G118100.1
    MESQAPPPKFARLSNSRTRLASGWNVERNRRDGESGSPPIGLGLELGRGGSSQRPIISCKKPYGFTVLQLQELQLQSLIYTYIQAGFPVPYHLVLPIWRSVATSLGGLSSRLYQLYPSLMGCNPLYLAYKNGMDPEPGRCRRTDGKKWRCSKEALPYQKYCDRHIHRGRQRSRKLEESASHGNSSTDLSISLPAGISGASA*