Gene Details:

  • Gene ID: GSBRNA2T00076094001
  • Gene Name: GSBRNA2T00076094001, GSBRNA2T00097284001
  • Gene Family: GRAS Family
  • Description: GRAS Family protein
  • Species: Brassica napus
  • Source: GRAS family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009130367.1  — PREDICTED: LOW QUALITY PROTEIN: DELLA protein RGL2
  • Refseq:  XP_013637838.1  — PREDICTED: DELLA protein RGL2
  • Refseq:  XP_013747675.1  — DELLA protein RGL2 isoform X3
  • Refseq:  XP_022569045.1  — DELLA protein RGL2 isoform X1
  • Refseq:  XP_022569046.1  — DELLA protein RGL2 isoform X2
  • Swissprot:  Q7Y1B6  — GAI_SOLLC; DELLA protein GAI
  • TrEMBL:  A0A078I207  — A0A078I207_BRANA; BnaA05g32630D protein
  • TrEMBL:  A0A0D3CN13  — A0A0D3CN13_BRAOL; Uncharacterized protein
  • TrEMBL:  A0A397ZJP9  — A0A397ZJP9_BRACM; Uncharacterized protein
  • TrEMBL:  A0A3P5ZGI2  — A0A3P5ZGI2_BRACM; Uncharacterized protein
  • TrEMBL:  A0A3P6FP66  — A0A3P6FP66_BRAOL; Uncharacterized protein
  • STRING:  Bo5g149920.1  — (Brassica oleracea)

Gene Ontology:

  • GO:1903506  — Biological Process — regulation of nucleic acid-templated transcription

Family Introduction:

  • The GRAS family of putative transcriptional regulators is found throughout the plant kingdom, and these proteins have diverse roles in plant development, including root development, axillary shoot development, and maintenance of the shoot apical meristem (Bolle, 2004). GRAS proteins show conserved residues in the C terminus but contain a variable N terminus with homopolymeric stretches of certain amino acids. It has recently been shown that two GRAS proteins that regulate root growth, SCARECROW (SCR) and SHORTROOT (SHR), interact with each other (Cui et al., 2007), while a class of GRAS proteins involved in regulating plant growth, the DELLA proteins, interact with a transcription factor involved in phytochrome signaling (de Lucas et al., 2008; Feng et al., 2008).

Literature:

Sequences:

CDS Sequence:
  • >GSBRNA2T00076094001|Brassica_napus|GRAS|GSBRNA2T00076094001
    ATGGGGTCCGTCGGGTTTGACCCGGTGCCGCTCGGATCCAGCGCGTTTAAGCAAGCGAGCATGCTCTTATCGGTTTTCGCCGGGGGAGATGGATACAGAGTTGAGGAGAACGACGGGTGTTTGATGTTGGGGTGGCAGACGAGGCCACTTATTGCCACGTCGGCGTGGAAACTCGCCGGAGCGTAG
Protein Sequence:
  • >GSBRNA2T00076094001|Brassica_napus|GRAS|GSBRNA2T00076094001
    MGSVGFDPVPLGSSAFKQASMLLSVFAGGDGYRVEENDGCLMLGWQTRPLIATSAWKLAGA*