Gene Details:

  • Gene ID: EcC045409.10
  • Gene Family: GRAS Family
  • Description: GRAS Family protein
  • Species: Eucalyptus camaldulensis
  • Source: GRAS family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_018727332.1  — PREDICTED: scarecrow-like protein 8 isoform X1
  • Refseq:  XP_018727334.1  — PREDICTED: scarecrow-like protein 8 isoform X2
  • Swissprot:  Q9FYR7  — SCL8_ARATH; Scarecrow-like protein 8
  • TrEMBL:  A0A059DD35  — A0A059DD35_EUCGR; Uncharacterized protein
  • STRING:  XP_010066861.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0015074  — Biological Process — DNA integration
  • GO:0003676  — Molecular Function — nucleic acid binding
  • GO:0008270  — Molecular Function — zinc ion binding

Family Introduction:

  • The GRAS family of putative transcriptional regulators is found throughout the plant kingdom, and these proteins have diverse roles in plant development, including root development, axillary shoot development, and maintenance of the shoot apical meristem (Bolle, 2004). GRAS proteins show conserved residues in the C terminus but contain a variable N terminus with homopolymeric stretches of certain amino acids. It has recently been shown that two GRAS proteins that regulate root growth, SCARECROW (SCR) and SHORTROOT (SHR), interact with each other (Cui et al., 2007), while a class of GRAS proteins involved in regulating plant growth, the DELLA proteins, interact with a transcription factor involved in phytochrome signaling (de Lucas et al., 2008; Feng et al., 2008).

Literature:

Sequences:

CDS Sequence:
  • >EcC045409.10|Eucalyptus_camaldulensis|GRAS|EcC045409.10
    TGGAGGCTGCGACGGCGATATACGAGGGCAAAGTAGACGTGGCTTCGGAGATCATGAGACGCTTGTCTGCCATGCCGAACCCCATGAGTAATTCAAAGCAGAAATTGATGGAATACATGTTGTCTGTGCTTAAATCGCGCGTGAGCCCAGTCGATTACCCCCCTTCCGTGGCGGAGTTGTTCACCGAGGAACATGTATTGTCGGCTCGATCACTCTACGAACTGTCTCCTTGTTTCTGGCTCGGTTTCATGGCTGCCAATAACGCGATTTTGGAAGCTGCATCGGAGCAACCCTCCACTAACAAGCTCCATGTATTTGATTTCGATATTGGTTGGGAACAACAGTACAACAATCTCCTGTTAGAAATTTCCTATAATATGGGCTTACAT
Protein Sequence:
  • >EcC045409.10|Eucalyptus_camaldulensis|GRAS|EcC045409.10
    EAATAIYEGKVDVASEIMRRLSAMPNPMSNSKQKLMEYMLSVLKSRVSPVDYPPSVAELFTEEHVLSARSLYELSPCFWLGFMAANNAILEAASEQPSTNKLHVFDFDIGWEQQYNNLLLEISYNMGLH