Gene Details:

  • Gene ID: Solyc02g014740.1.1
  • Gene Family: GeBP Family
  • Description: GeBP Family protein
  • Species: Solanum lycopersicum
  • Source: GeBP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_025884855.1  — probable transcription factor At4g00610, partial
  • TrEMBL:  A0A3Q7EVX9  — A0A3Q7EVX9_SOLLC; Uncharacterized protein
  • STRING:  Solyc02g014740.1.1  — (Solanum lycopersicum)

Family Introduction:

  • Understanding the role of transcription factors (TFs) is essential in reconstructing developmental regulatory networks. The plant-specific GeBP TF family of Arabidopsis thaliana (Arabidopsis) comprises 21 members, all of unknown function. A subset of four members, the founding member GeBP and GeBP-like proteins (GPL) 1, 2, and 3, shares a conserved C-terminal domain.
  • Here we report that GeBP/GPL genes represent a newly defined class of leucine-zipper (Leu-zipper) TFs and that they play a redundant role in cytokinin hormone pathway regulation. Specifically, we demonstrate using yeast, in vitro, and split-yellow fluorescent protein in planta assays that GeBP/GPL proteins form homo- and heterodimers through a noncanonical Leu-zipper motif located in the C-terminal domain.
  • A triple loss-of-function mutant of the three most closely related genes gebp gpl1 gpl2 shows a reduced sensitivity to exogenous cytokinins in a subset of cytokinin responses such as senescence and growth, whereas root inhibition is not affected. We find that transcript levels of type-A cytokinin response genes, which are involved in the negative feedback regulation of cytokinin signaling, are higher in the triple mutant. Using a GPL version that acts as a constitutive transcriptional activator, we show that the regulation of Arabidopsis response regulators (ARRs) is mediated by at least one additional, as yet unknown, repressor acting genetically downstream in the GeBP/GPL pathway.
  • Our results indicate that GeBP/GPL genes encode a new class of unconventional Leu-zipper TF proteins and suggest that their role in the cytokinin pathway is to antagonize the negative feedback regulation on ARR genes to trigger the cytokinin response.

Literature:

Sequences:

CDS Sequence:
  • >Solyc02g014740.1.1|Solanum_lycopersicum|GeBP|Solyc02g014740.1.1
    ATGACAGAAAATTCAACCACAGGTGCAGCAAATTGTAGTGTGGAGTTTGTGAGAGAAGAAGAGGAGATAGTGTCAAACAAAAGGAAAAACGATGATATCGATGTCACAAGGTTTCTCTATAATGATACTCCTTCCGATGGATATTATCAAGAGAAAACTCCTTCTCCCAAGCCCAAGAGGAAGATGAATCTGAAATCCAAACCTCCTCTGTTTTCAAAAGTGTGGAGTGATGAAGATGAGGTTTCCCTACTCAAAGGTATCATTAAGTTCAAGGAACAAACAGCTTGTGAAATCACGCAATGTATGACAGAATTTCGTGCATTTATCCTTCCATCACTTACTCTTCAACCTACGCGTGTTCAATTGAGAGAGAAAATAAGACGTCTAAAAAAAAGGTATGAAAAGACTCTTGCCACAGGAAATTCTTCTAATACAGACGTGCACCAACTCGAACTGTTCCAGTTATGTCGCATAATTTGGACTCAACCTCCTAACTCTCTACTGCTAAAGGAGAAGCGAGAAGATGGGCTTCAGGTAAAGGAGAAACACAACAATCCAGAGCTGGAAAAGCAGAATATACAGGTAAATGAGAAGAAGCACAATATTCCACAAAAAGGGCAGCCGGAAAAGCAGGAGAGGAAGCACAACATGCGGCCAATTCAGCAGCATNNN
Protein Sequence:
  • >Solyc02g014740.1.1|Solanum_lycopersicum|GeBP|Solyc02g014740.1.1
    MTENSTTGAANCSVEFVREEEEIVSNKRKNDDIDVTRFLYNDTPSDGYYQEKTPSPKPKRKMNLKSKPPLFSKVWSDEDEVSLLKGIIKFKEQTACEITQCMTEFRAFILPSLTLQPTRVQLREKIRRLKKRYEKTLATGNSSNTDVHQLELFQLCRIIWTQPPNSLLLKEKREDGLQVKEKHNNPELEKQNIQVNEKKHNIPQKGQPEKQERKHNMRPIQQHX