Gene Details:
- Gene ID: PGSC0003DMP400018713
- Gene Family: GeBP Family
- Description: GeBP Family protein
- Species: Solanum tuberosum
- Source: GeBP family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_006354969.2 — PREDICTED: uncharacterized protein LOC102600510
- TrEMBL: M1APP4 — M1APP4_SOLTU; Uncharacterized protein
- TrEMBL: M1APP5 — M1APP5_SOLTU; Uncharacterized protein
- STRING: PGSC0003DMT400027440 — (Solanum tuberosum)
Family Introduction:
- Understanding the role of transcription factors (TFs) is essential in reconstructing developmental regulatory networks. The plant-specific GeBP TF family of Arabidopsis thaliana (Arabidopsis) comprises 21 members, all of unknown function. A subset of four members, the founding member GeBP and GeBP-like proteins (GPL) 1, 2, and 3, shares a conserved C-terminal domain.
- Here we report that GeBP/GPL genes represent a newly defined class of leucine-zipper (Leu-zipper) TFs and that they play a redundant role in cytokinin hormone pathway regulation. Specifically, we demonstrate using yeast, in vitro, and split-yellow fluorescent protein in planta assays that GeBP/GPL proteins form homo- and heterodimers through a noncanonical Leu-zipper motif located in the C-terminal domain.
- A triple loss-of-function mutant of the three most closely related genes gebp gpl1 gpl2 shows a reduced sensitivity to exogenous cytokinins in a subset of cytokinin responses such as senescence and growth, whereas root inhibition is not affected. We find that transcript levels of type-A cytokinin response genes, which are involved in the negative feedback regulation of cytokinin signaling, are higher in the triple mutant. Using a GPL version that acts as a constitutive transcriptional activator, we show that the regulation of Arabidopsis response regulators (ARRs) is mediated by at least one additional, as yet unknown, repressor acting genetically downstream in the GeBP/GPL pathway.
- Our results indicate that GeBP/GPL genes encode a new class of unconventional Leu-zipper TF proteins and suggest that their role in the cytokinin pathway is to antagonize the negative feedback regulation on ARR genes to trigger the cytokinin response.
Literature:
- GeBP and GeBP-Like Proteins Are Noncanonical Leucine-Zipper Transcription Factors That Regulate Cytokinin Response in Arabidopsis. DOI: 10.1104/pp.107.110270 ; PMID: 18162594
Sequences:
CDS Sequence:
- >PGSC0003DMP400018713|Solanum_tuberosum|GeBP|PGSC0003DMP400018713
ATGATGAAACTGAAATCCAAACCTCCCCTTTTTTCAAAAGTGTGGAGTGATGAAGATGAAATTTCCCTACTCACAGGTATCATTAAGTTCAAGGAACAAACAGCTCGTGAAGTTGCACAAAATATGGCCGAATTTCGTGCATTTATCCTTCCTTCACTTACTCTTCAACCTACGCCTGTCCAATTAAGGGAGAAAATAAGGCGTATCAGACTAAAGTATGAAAAGACTCTTGTCACAGGAAATCCTTCTAATACAGACCTGCACCAAGTCCAAGTGTTCCAATTATGTCAGAAAATTTGGACTCAACCTCCTAACTCCAACTCTCTACTGCTAAAGGAGAAGCACAACATTCCAGAAAACGACCTACAGGTAAAGGAGAAACACAACATTCCAGAAAATGGCCTACAGGTAAAGGAGAAGCACAACATTCCAGAAAATGGGCAGCCAGAAAAGCAGAATCTACTGGTAAAGGAGAAGAAGCACAACATTCGACCGATTCAGCAGCATAAAATTATCCCCGATTCTGGACTGGATGGGAAAACTATGGAAGATTTGTTGAAGCGACTAGCCAAAGATGTAGAACTTGTTGTAAATTCTAAGGCATGTTTGCAAGGAAATAGTAATGAAGTTGGTATAAGAGTGCTTGATATTGGCCTAGAAAGTATGAAATTAGGGATAAAGTTGGGGAAATTGGTGCACGAGAAAGCGACTTCGCCTGAGTTGGTATAA
Protein Sequence:
- >PGSC0003DMP400018713|Solanum_tuberosum|GeBP|PGSC0003DMP400018713
MMKLKSKPPLFSKVWSDEDEISLLTGIIKFKEQTAREVAQNMAEFRAFILPSLTLQPTPVQLREKIRRIRLKYEKTLVTGNPSNTDLHQVQVFQLCQKIWTQPPNSNSLLLKEKHNIPENDLQVKEKHNIPENGLQVKEKHNIPENGQPEKQNLLVKEKKHNIRPIQQHKIIPDSGLDGKTMEDLLKRLAKDVELVVNSKACLQGNSNEVGIRVLDIGLESMKLGIKLGKLVHEKATSPELV*