Information report for Achn056961
Gene Details
|
|
Functional Annotation
- Refseq: XP_028079823.1 — probable transcription factor At3g04930
- Refseq: XP_028079824.1 — probable transcription factor At3g04930
- Refseq: XP_028079825.1 — probable transcription factor At3g04930
- TrEMBL: A0A2R6RBD9 — A0A2R6RBD9_ACTCH; Transcription factor
- STRING: Solyc02g083750.1.1 — (Solanum lycopersicum)
Family Introduction
- Understanding the role of transcription factors (TFs) is essential in reconstructing developmental regulatory networks. The plant-specific GeBP TF family of Arabidopsis thaliana (Arabidopsis) comprises 21 members, all of unknown function. A subset of four members, the founding member GeBP and GeBP-like proteins (GPL) 1, 2, and 3, shares a conserved C-terminal domain.
- Here we report that GeBP/GPL genes represent a newly defined class of leucine-zipper (Leu-zipper) TFs and that they play a redundant role in cytokinin hormone pathway regulation. Specifically, we demonstrate using yeast, in vitro, and split-yellow fluorescent protein in planta assays that GeBP/GPL proteins form homo- and heterodimers through a noncanonical Leu-zipper motif located in the C-terminal domain.
- A triple loss-of-function mutant of the three most closely related genes gebp gpl1 gpl2 shows a reduced sensitivity to exogenous cytokinins in a subset of cytokinin responses such as senescence and growth, whereas root inhibition is not affected. We find that transcript levels of type-A cytokinin response genes, which are involved in the negative feedback regulation of cytokinin signaling, are higher in the triple mutant. Using a GPL version that acts as a constitutive transcriptional activator, we show that the regulation of Arabidopsis response regulators (ARRs) is mediated by at least one additional, as yet unknown, repressor acting genetically downstream in the GeBP/GPL pathway.
- Our results indicate that GeBP/GPL genes encode a new class of unconventional Leu-zipper TF proteins and suggest that their role in the cytokinin pathway is to antagonize the negative feedback regulation on ARR genes to trigger the cytokinin response.
Literature and News
Homologs
- Capsicum annuum: CA10g07350
- Daucus carota: DCAR_029727
- Glycine max: Glyma.19G242600.1.p, Glyma.03G245200.1.p
- Lactuca sativa: Lsa015161
- Nicotiana tabacum: XP_016489373.1, XP_016507116.1, XP_016452114.1, XP_016461631.1
- Petunia inflata: Peinf101Scf00120g15004.1
- Solanum lycopersicum: Solyc02g083750.1.1
- Solanum melongena: Sme2.5_00015.1_g00030.1
- Solanum tuberosum: PGSC0003DMP400006375
- Ziziphus jujuba: XP_015875499.1
Sequences
CDS Sequence:
- >Achn056961|Actinidia_chinensis|GeBP|Achn056961
ATGGCTTCCGAAGAGGATCCCACCGTCTATGGCGAAGAAGACCTCGACGAAGACGACGAAGAAGACAGCGAAGAAGACGAGGGTCTAACCATCCCCACCTCCAACCCTCCCCAACCGGACCTCGACGACGACCTCGACGACGATGATCTCCTCGACGACGACGACGACACTTCATCCTCCGCCGGCAAGGTCACTGTCGCAATCGCCGCCGTCCCCAACGGCGACCCCTCCAAACCCGTCGCATCCGGCCTCGTCACCGTCGCAGCCGCCGATTCCCTCCTCCCCGATCCGAAACGCCACCGCATCGAGGAGGTCACGATCGCTGCCGCCGCGGAGAAGAAGCCGTCGGCGGCGATGGACGACTCGAGGCGGCTATTCCAGCGGCTGTGGACCGACGAGGACGAGATCGAGCTGTTGCAGGGGTTCCTCGACTACACGGCGCAGCGAGGGGGAGGCGGAGGAGGGAATTCGTCGCACCACCACCACTACGACACGACGGTGTTCTACGACCAGATCAAGAGTAAGCTTCAGCTCGATTTCAACAAGAACCAGTTAGTCGAGAAGCTGAGGAGATTGAAGAAGAAGTATCGAAACGTTTTGAACAAGATCGGTTCCGGTAAAGAGTATGCATTCAAAAGCCCCCACGATCAGGCCACTTTCGAGATCTCTCGCAAGATCTGGAGCGGAGGCGGATTAGATGACGATGAAGCAAATCCTAACTCTAACTCAAACCCTAACCCTAATTTCTTTGATCACAACAATAACGGTATTGATACCAATAGCTTGGAGAGGAAGGGTTCAAAGTCCCGAAAACGATCGAGAGTGAAAATTGAGGAAAAGCAACAATTCAATCAACAGGTTCCCCCAACTGCGACTCCAACTGCGACCCCAACTGCGACCTCAATTCCTAATTTGATTGAGGAGACAGTGAGGAGCTGTCTATCCCCATTGTTTAAGGAGTTGCTTCACAATGCGACGAGTGGGGTGAATGGTTCTCGGGGGTACAGTGGCGTGGCCGCGCTGAATCCGATGCCTTTGGGTTTTGGGAGTCCGTTGGGATTGAATTTTTCAGGTGGAGATGTGATGGATGAGAAGTGGAGGAAGCAACAGATATTGGAGTTGGAGGTGTATTCGAAGCGGTTGGAGTTGGTGCAGGATCAGATTAAGTCGGCGCTGGAAGAACTGAGATCAATGGGAAGCTGA
Protein Sequence:
- >Achn056961|Actinidia_chinensis|GeBP|Achn056961
MASEEDPTVYGEEDLDEDDEEDSEEDEGLTIPTSNPPQPDLDDDLDDDDLLDDDDDTSSSAGKVTVAIAAVPNGDPSKPVASGLVTVAAADSLLPDPKRHRIEEVTIAAAAEKKPSAAMDDSRRLFQRLWTDEDEIELLQGFLDYTAQRGGGGGGNSSHHHHYDTTVFYDQIKSKLQLDFNKNQLVEKLRRLKKKYRNVLNKIGSGKEYAFKSPHDQATFEISRKIWSGGGLDDDEANPNSNSNPNPNFFDHNNNGIDTNSLERKGSKSRKRSRVKIEEKQQFNQQVPPTATPTATPTATSIPNLIEETVRSCLSPLFKELLHNATSGVNGSRGYSGVAALNPMPLGFGSPLGLNFSGGDVMDEKWRKQQILELEVYSKRLELVQDQIKSALEELRSMGS*