Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_019229206.1  — PREDICTED: GATA transcription factor 1-like
  • TrEMBL:  A0A314KLR2  — A0A314KLR2_NICAT; Gata transcription factor 1
  • STRING:  XP_009767386.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0007623  — Biological Process — circadian rhythm
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0008270  — Molecular Function — zinc ion binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0044212  — Molecular Function — transcription regulatory region DNA binding

Family Introduction:

  • GATA factors were first identified as proteins that interact with conserved WGATAR (W = T or A; R = G or A) motifs involved in erythroid-specific gene expressionin vertebrates.
  • GATA factors are characterised by the presence of conserved, type-IV zinc-finger motifs Animal factors typically contain two C-x2-Cx17-C-x2-C zinc-finger domains. The majority of known fungal GATA factors contain a single C-x2-C-x17-C-x2-C finger with greatest similarity to the carboxyl (C) terminal finger of animal GATA factors.Several examples of fungal GATA factors containing a variant C-x2-C-x18-C-x2-C DNA-binding domain are also known.
  • Examples of both C-x2-C-x17-Cx2-C (Type IVa) and C-x2-C-x18-C-x2-C (Type IVb) GATA factors are found within fungi; animals onlycontain the former configuration, and plants only the latter. Plant GATA factors typically contain a single zinc finger. The Arabidopsis type-IV zinc-finger proteins may represent the previously defined family of nuclear GATA-binding proteins implicated in light-responsive transcription.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf09192g01004.1|Nicotiana_benthamiana|GATA|Niben101Scf09192g01004.1
Protein Sequence:
  • >Niben101Scf09192g01004.1|Nicotiana_benthamiana|GATA|Niben101Scf09192g01004.1
    MKMEALDPSAASCFMVDVDDDLLNFSLEDETVLDDDEKTTNSITKHTHPFSSSYSSSLDSSNPVLSLLPSQQHPECIEEELEWLSNKDAFPAVEFGILADNPNIVFDHHSPVSVLENSSSTCNSSGTSSANANAYMSCCASLKVPVNYPVRARSKRRRRRRRGSFADLPSEHCMLVNKPSFKSFKQHEPLLSLPVNSAKSASIGRRCQHCGADKTPQWRAGPLGPKTLCNACGVRFKSGRLLPEYRPANSPTFSPTVHSNSHRKVLEMRKQKIGVGGMMIHEACGYRVG