Gene Details:
- Gene ID: KZV44144.1
- Gene Family: GATA Family
- Description: GATA Family protein
- Species: Dorcoceras hygrometricum
- Source: GATA family gene from PlantTFDB
Protein Features:
- SMART: SM00401
- PROSITE profile: PS50114
- Gene3D: G3DSA:3.30.50.10
- SuperFamily: SSF57716
- Pfam: PF00320
- InterPro: IPR000679 IPR013088
Annotation Proteins:
- Refseq: XP_011079598.1 — GATA transcription factor 15
- Swissprot: Q8LG10 — GAT15_ARATH; GATA transcription factor 15
- TrEMBL: A0A2Z7CI13 — A0A2Z7CI13_9LAMI; GATA transcription factor 15-like
- STRING: Migut.D00108.1.p — (Erythranthe guttata)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0008270 — Molecular Function — zinc ion binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction:
- GATA factors were first identified as proteins that interact with conserved WGATAR (W = T or A; R = G or A) motifs involved in erythroid-specific gene expressionin vertebrates.
- GATA factors are characterised by the presence of conserved, type-IV zinc-finger motifs Animal factors typically contain two C-x2-Cx17-C-x2-C zinc-finger domains. The majority of known fungal GATA factors contain a single C-x2-C-x17-C-x2-C finger with greatest similarity to the carboxyl (C) terminal finger of animal GATA factors.Several examples of fungal GATA factors containing a variant C-x2-C-x18-C-x2-C DNA-binding domain are also known.
- Examples of both C-x2-C-x17-Cx2-C (Type IVa) and C-x2-C-x18-C-x2-C (Type IVb) GATA factors are found within fungi; animals onlycontain the former configuration, and plants only the latter. Plant GATA factors typically contain a single zinc finger. The Arabidopsis type-IV zinc-finger proteins may represent the previously defined family of nuclear GATA-binding proteins implicated in light-responsive transcription.
Literature:
- Arabidopsis thaliana GATA factors: organisation, expression and DNA-binding characteristics. DOI: 10.1023/a:1016062325584 ; PMID: 12139008
Sequences:
CDS Sequence:
- >KZV44144.1|Dorcoceras_hygrometricum|GATA|KZV44144.1
ATGGATCTGAAAGAGCATGAGAAGCAAGATTCCGATGAGCCAAATAGTGAAAGGTGTTCGGTGAAATGCTGCAACGGCTGTCGCACTACCAGAACGCCCCTTTGGAGAGGCGGCCCGGAGGGACCCAAGTCTCTGTGTAATGCCTGTGGGATCAAATACAATAAGAAGAGACGCCAGCTGATGGGTTTCGATACTGGAAGAAGTACCCACAAGAAGAAGAAGCGAAGCTCTGTAAATCGTGGTAATGGGGTTGGAGAGGTTTTGAAAATGCGATTTATGGCTTCGGGTGGTGAAGTTGTGTTTCAGAGGTCTGGGAAGATGTTGAGCAAGTTGAGGGAAGAAGAGCAGGCGGCTATACTGTTGATGGCTCTTTCTTACGGATCTGTTTACACTTAG
Protein Sequence:
- >KZV44144.1|Dorcoceras_hygrometricum|GATA|KZV44144.1
MDLKEHEKQDSDEPNSERCSVKCCNGCRTTRTPLWRGGPEGPKSLCNACGIKYNKKRRQLMGFDTGRSTHKKKKRSSVNRGNGVGEVLKMRFMASGGEVVFQRSGKMLSKLREEEQAAILLMALSYGSVYT