Gene Details:
- Gene ID: KN540203.1_FGP003
- Gene Family: GATA Family
- Description: GATA Family protein
- Species: Oryza longistaminata
- Source: GATA family gene from PlantTFDB
Protein Features:
- SMART: SM00401
- PROSITE profile: PS50114
- Gene3D: G3DSA:3.30.50.10
- SuperFamily: SSF57716
- Pfam: PF00320
- InterPro: IPR000679 IPR013088
Annotation Proteins:
- Refseq: XP_015631979.1 — GATA transcription factor 16
- TrEMBL: A0A0D3FQY4 — A0A0D3FQY4_9ORYZ; Uncharacterized protein
- TrEMBL: A0A0D9ZFB6 — A0A0D9ZFB6_9ORYZ; Uncharacterized protein
- TrEMBL: A0A0E0GVZ0 — A0A0E0GVZ0_ORYNI; Uncharacterized protein
- TrEMBL: A0A0E0P3H0 — A0A0E0P3H0_ORYRU; Uncharacterized protein
- TrEMBL: A2XNM3 — A2XNM3_ORYSI; Uncharacterized protein
- TrEMBL: Q850Z5 — Q850Z5_ORYSJ; Expressed protein
- STRING: OGLUM03G39650.1 — (Oryza glumipatula)
- STRING: ORUFI03G41540.1 — (Oryza rufipogon)
- STRING: OS03T0831200-01 — (Oryza sativa)
- STRING: ONIVA03G41600.1 — (Oryza nivara)
- STRING: OBART03G39750.1 — (Oryza barthii)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0008270 — Molecular Function — zinc ion binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction:
- GATA factors were first identified as proteins that interact with conserved WGATAR (W = T or A; R = G or A) motifs involved in erythroid-specific gene expressionin vertebrates.
- GATA factors are characterised by the presence of conserved, type-IV zinc-finger motifs Animal factors typically contain two C-x2-Cx17-C-x2-C zinc-finger domains. The majority of known fungal GATA factors contain a single C-x2-C-x17-C-x2-C finger with greatest similarity to the carboxyl (C) terminal finger of animal GATA factors.Several examples of fungal GATA factors containing a variant C-x2-C-x18-C-x2-C DNA-binding domain are also known.
- Examples of both C-x2-C-x17-Cx2-C (Type IVa) and C-x2-C-x18-C-x2-C (Type IVb) GATA factors are found within fungi; animals onlycontain the former configuration, and plants only the latter. Plant GATA factors typically contain a single zinc finger. The Arabidopsis type-IV zinc-finger proteins may represent the previously defined family of nuclear GATA-binding proteins implicated in light-responsive transcription.
Literature:
- Arabidopsis thaliana GATA factors: organisation, expression and DNA-binding characteristics. DOI: 10.1023/a:1016062325584 ; PMID: 12139008
Sequences:
CDS Sequence:
- >KN540203.1_FGP003|Oryza_longistaminata|GATA|KN540203.1_FGP003
ATGTCGACGCCGCTCTGGCGAAATGGTCCCAGGGGACCCAAGTCGCTGTGCAACGCGTGCGGGATCCGGTACCGGAAGAAGAGACGGGAGGCGCTGGGGCTCGACGCCGGCGAGGGCGGCGCGGAGCGGCAGGAGAAGAAGAAGAGCAAGAGGGAGAGAGGGGAGGAGGTGACCATGGAGCTCCGCATGGTGGGGTTCGGGAAGGAGGGTTTATCAGTCGAAACCAACCAATCACACATTCAGACGGAGGACTGGAGGATGGAGAGTGACAATGACTAA
Protein Sequence:
- >KN540203.1_FGP003|Oryza_longistaminata|GATA|KN540203.1_FGP003
MSTPLWRNGPRGPKSLCNACGIRYRKKRREALGLDAGEGGAERQEKKKSKRERGEEVTMELRMVGFGKEGLSVETNQSHIQTEDWRMESDND