Gene Details:

  • Gene ID: KHN03949.1
  • Gene Family: GATA Family
  • Description: GATA Family protein
  • Species: Glycine soja
  • Source: GATA family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_014495606.1  — GATA transcription factor 16
  • Swissprot:  Q9FJ10  — GAT16_ARATH; GATA transcription factor 16
  • TrEMBL:  A0A445LG49  — A0A445LG49_GLYSO; GATA transcription factor 16 isoform A
  • TrEMBL:  I1JR72  — I1JR72_SOYBN; Uncharacterized protein
  • STRING:  GLYMA03G39220.1  — (Glycine max)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0008270  — Molecular Function — zinc ion binding
  • GO:0016740  — Molecular Function — transferase activity
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • GATA factors were first identified as proteins that interact with conserved WGATAR (W = T or A; R = G or A) motifs involved in erythroid-specific gene expressionin vertebrates.
  • GATA factors are characterised by the presence of conserved, type-IV zinc-finger motifs Animal factors typically contain two C-x2-Cx17-C-x2-C zinc-finger domains. The majority of known fungal GATA factors contain a single C-x2-C-x17-C-x2-C finger with greatest similarity to the carboxyl (C) terminal finger of animal GATA factors.Several examples of fungal GATA factors containing a variant C-x2-C-x18-C-x2-C DNA-binding domain are also known.
  • Examples of both C-x2-C-x17-Cx2-C (Type IVa) and C-x2-C-x18-C-x2-C (Type IVb) GATA factors are found within fungi; animals onlycontain the former configuration, and plants only the latter. Plant GATA factors typically contain a single zinc finger. The Arabidopsis type-IV zinc-finger proteins may represent the previously defined family of nuclear GATA-binding proteins implicated in light-responsive transcription.

Literature:

Sequences:

CDS Sequence:
  • >KHN03949.1|Glycine_soja|GATA|KHN03949.1
    ATGGATCTGAATGTGAATGAGAAAAAGAAATGTTGCGCTGATTGCAAAACCACCAAGACACCACTCTGGAGAGGAGGACCAGCTGGACCCAAGACCTTATGCAACGCTTGTGGAATTAGGTATAGGAAGAGAAGGGCTTGTTCGAGGAAGCGAGAGGAGCAGAGGTGGAAGATGTTGGGGGAAGAGGAACAGGCCGCGGTGTGCTTGATGGCCTTGTCCTCTGGTTTTGTTTTCGCTTGA
Protein Sequence:
  • >KHN03949.1|Glycine_soja|GATA|KHN03949.1
    MDLNVNEKKKCCADCKTTKTPLWRGGPAGPKTLCNACGIRYRKRRACSRKREEQRWKMLGEEEQAAVCLMALSSGFVFA