Gene Details:
- Gene ID: cra_locus_7877_iso_2
- Gene Family: GATA Family
- Description: GATA Family protein
- Species: Catharanthus roseus
- Source: GATA family gene from PlantTFDB
Protein Features:
- SMART: SM00401
- PROSITE profile: PS50114
- Gene3D: G3DSA:3.30.50.10
- SuperFamily: SSF57716
- Pfam: PF00320
- InterPro: IPR000679 IPR013088
Annotation Proteins:
- Refseq: XP_011078200.2 — LOW QUALITY PROTEIN: putative GATA transcription factor 22
- TrEMBL: A0A068U3P2 — A0A068U3P2_COFCA; Uncharacterized protein
- STRING: XP_010262144.1 — (Nelumbo nucifera)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0007623 — Biological Process — circadian rhythm
- GO:0009416 — Biological Process — response to light stimulus
- GO:0009735 — Biological Process — response to cytokinin
- GO:0009740 — Biological Process — gibberellic acid mediated signaling pathway
- GO:0009910 — Biological Process — negative regulation of flower development
- GO:0010187 — Biological Process — negative regulation of seed germination
- GO:0010380 — Biological Process — regulation of chlorophyll biosynthetic process
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0008270 — Molecular Function — zinc ion binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
- GO:0044212 — Molecular Function — transcription regulatory region DNA binding
Family Introduction:
- GATA factors were first identified as proteins that interact with conserved WGATAR (W = T or A; R = G or A) motifs involved in erythroid-specific gene expressionin vertebrates.
- GATA factors are characterised by the presence of conserved, type-IV zinc-finger motifs Animal factors typically contain two C-x2-Cx17-C-x2-C zinc-finger domains. The majority of known fungal GATA factors contain a single C-x2-C-x17-C-x2-C finger with greatest similarity to the carboxyl (C) terminal finger of animal GATA factors.Several examples of fungal GATA factors containing a variant C-x2-C-x18-C-x2-C DNA-binding domain are also known.
- Examples of both C-x2-C-x17-Cx2-C (Type IVa) and C-x2-C-x18-C-x2-C (Type IVb) GATA factors are found within fungi; animals onlycontain the former configuration, and plants only the latter. Plant GATA factors typically contain a single zinc finger. The Arabidopsis type-IV zinc-finger proteins may represent the previously defined family of nuclear GATA-binding proteins implicated in light-responsive transcription.
Literature:
- Arabidopsis thaliana GATA factors: organisation, expression and DNA-binding characteristics. DOI: 10.1023/a:1016062325584 ; PMID: 12139008
Sequences:
CDS Sequence:
- >cra_locus_7877_iso_2|Catharanthus_roseus|GATA|cra_locus_7877_iso_2
Protein Sequence:
- >cra_locus_7877_iso_2|Catharanthus_roseus|GATA|cra_locus_7877_iso_2
XLSIHHRVFFDSSTTPPPPPDQTQFYTTTTTMLHHPPPHHQDHQDENQAGSYDDDLQGKEGGNKRLKLTLWKNNNEKQENNIPAAKWMSSKMRIMHKMKNSTTTGHNNNKVEDHHHHQQQKQGSYNSTTSFEGDHNLSSCSYNNNSNPPVRVCTDCNTTKTPLWRSGPKGPKSLCNACGIRQRKARRAMAAAAAAATAGGTSQVNYETATTSSTLKMKEKKNNGGRGSGVHLKKGCKMTSAAESSSSADDHNEEEKKKNVFEDFLLNLSKNLAFHRVFPQDEKEAAILLMALSCGLVHG