Gene Details:
- Gene ID: Bradi3g33200.1.p
- Gene Name: BRADI_3g33200, LOC100844292
- Gene Family: GATA Family
- Description: GATA Family protein
- Species: Brachypodium distachyon
- Source: GATA family gene from PlantTFDB
Protein Features:
- SMART: SM00401
- PROSITE profile: PS50114
- Gene3D: G3DSA:3.30.50.10
- SuperFamily: SSF57716
- Pfam: PF00320
- InterPro: IPR000679 IPR013088
Annotation Proteins:
- Refseq: XP_003574323.1 — GATA transcription factor 2
- TrEMBL: I1I637 — I1I637_BRADI; GATA transcription factor
- STRING: BRADI3G33200.1 — (Brachypodium distachyon)
Gene Ontology:
- GO:0030154 — Biological Process — cell differentiation
- GO:0045944 — Biological Process — positive regulation of transcription from RNA polymerase II promoter
- GO:0005634 — Cellular Component — nucleus
- GO:0005667 — Cellular Component — transcription factor complex
- GO:0000977 — Molecular Function — RNA polymerase II regulatory region sequence-specific DNA binding
- GO:0001085 — Molecular Function — RNA polymerase II transcription factor binding
- GO:0001228 — Molecular Function — transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
- GO:0003682 — Molecular Function — chromatin binding
- GO:0008270 — Molecular Function — zinc ion binding
Family Introduction:
- GATA factors were first identified as proteins that interact with conserved WGATAR (W = T or A; R = G or A) motifs involved in erythroid-specific gene expressionin vertebrates.
- GATA factors are characterised by the presence of conserved, type-IV zinc-finger motifs Animal factors typically contain two C-x2-Cx17-C-x2-C zinc-finger domains. The majority of known fungal GATA factors contain a single C-x2-C-x17-C-x2-C finger with greatest similarity to the carboxyl (C) terminal finger of animal GATA factors.Several examples of fungal GATA factors containing a variant C-x2-C-x18-C-x2-C DNA-binding domain are also known.
- Examples of both C-x2-C-x17-Cx2-C (Type IVa) and C-x2-C-x18-C-x2-C (Type IVb) GATA factors are found within fungi; animals onlycontain the former configuration, and plants only the latter. Plant GATA factors typically contain a single zinc finger. The Arabidopsis type-IV zinc-finger proteins may represent the previously defined family of nuclear GATA-binding proteins implicated in light-responsive transcription.
Literature:
- Arabidopsis thaliana GATA factors: organisation, expression and DNA-binding characteristics. DOI: 10.1023/a:1016062325584 ; PMID: 12139008
Sequences:
CDS Sequence:
- >Bradi3g33200.1.p|Brachypodium_distachyon|GATA|Bradi3g33200.1.p
ATGGCGTCGGAGTGGGAAATTGCCATGGGCGTGGAGCTCGGCATGGGAATGGGCGCGTACAACACCACCTCCAGCGCCGGCGCCGCTGCACCGATGGGCCACCACGCGGGCGGCGGCTACCATTTCTACGGGATGCAGCCGATGGGCGCCGCCGACCCTTCCATGCGCGTGGACGAGCTCCTCGACCTCTCCAGCGCCGGCGCCGGCGCGCACGACTTCTTCCCCGCCGCCGCCGCGGACAACGGGCACTACCACTACCACCACCTCGGCCCCGGCGTCGGCGAGCCGTCGGCGGCCACTACTCCGTCCGCCACGTCGTCGGATCACCAGACGTCCATGCTCTCCTTCGCCGACGAGTTCTACATACCCAGCGAGGAGGCCGCGGAGCTGGAGTGGCTATCCAAGTTCGTGGACGACTCCTACTCCGACATGCCGAATTACTCCTCGGCCGCACACGCGGCAATGGCGAAGGCTGCTGCCGCGGCCAGTAACAGCCCGGCTGGTCAGCATGGCAGCTGCATCACAGCGGCGGCTCCGCCGGGCCGCGGCGCGCGGAGCAAGCGGTCCCGTGCGAGCGCCGCGGCCGCCGCCGCGTGGCACTCCCTGATGCCGCGCCCGCCTTCGCAGTCATCGCCTTCCTCCTCGTCCTGCTCGTCGTCCGACATCCCGGCGTCCTCGAACAAGCCGGCCCGGCCCAACAACAGCAACGGCAGCCGCGGCAAGAAGCAGGGCCCCCCCGTGGCGGACCAGTCCGTGGGCCTGGTGGAGGGAGGCGTGAGGCGGTGCACGCACTGCGCGTCGGAGAAAACGCCGCAGTGGCGGACGGGCCCGCTGGGGCCCAAGACGCTGTGCAATGCCTGCGGGGTACGGTTCAAGTCGGGCCGGCTGGTGCCCGAGTACCGGCCGGCGGCCAGCCCGACGTTCCTGCTCACGCAGCACTCCAACTCGCACCGCAAGGTCATGGAGCTCCGCCGGCAGAAGGAGATCGTCCTCATCCGCGGCAGCCACCCCTCGGTGCCGACGGGGCCCGCCGGGGCGGCGACCGTGAAGCCGGAGCTCCTCTTCCGTGACTACGGCATCTGTTAA
Protein Sequence:
- >Bradi3g33200.1.p|Brachypodium_distachyon|GATA|Bradi3g33200.1.p
MASEWEIAMGVELGMGMGAYNTTSSAGAAAPMGHHAGGGYHFYGMQPMGAADPSMRVDELLDLSSAGAGAHDFFPAAAADNGHYHYHHLGPGVGEPSAATTPSATSSDHQTSMLSFADEFYIPSEEAAELEWLSKFVDDSYSDMPNYSSAAHAAMAKAAAAASNSPAGQHGSCITAAAPPGRGARSKRSRASAAAAAAWHSLMPRPPSQSSPSSSSCSSSDIPASSNKPARPNNSNGSRGKKQGPPVADQSVGLVEGGVRRCTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLVPEYRPAASPTFLLTQHSNSHRKVMELRRQKEIVLIRGSHPSVPTGPAGAATVKPELLFRDYGIC*