Information report for EMT02164
Gene Details
Functional Annotation
- Refseq: XP_020191527.1 — probable transcription factor GLK1
- Swissprot: Q5Z5I4 — GLK1_ORYSJ; Probable transcription factor GLK1
- TrEMBL: A0A453SAK8 — A0A453SAK8_AEGTS; Uncharacterized protein
- STRING: EMT02164 — (Aegilops tauschii)
- GO:0007165 — Biological Process — signal transduction
- GO:0009658 — Biological Process — chloroplast organization
- GO:0009910 — Biological Process — negative regulation of flower development
- GO:0010380 — Biological Process — regulation of chlorophyll biosynthetic process
- GO:0010638 — Biological Process — positive regulation of organelle organization
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:1900056 — Biological Process — negative regulation of leaf senescence
- GO:0005634 — Cellular Component — nucleus
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0044212 — Molecular Function — transcription regulatory region DNA binding
Family Introduction
- The GLK proteins are members of the recently categorized GARP superfamily of transcription factors (Riechmann et al., 2000) defined by G2 in maize; the Arabidopsis RESPONSE REGULATOR-B (ARR-B) proteins (Imamura et al., 1999); and the PHOSPHATE STARVATION RESPONSE1 (PSR1) protein of Chlamydomonas (Wykoff et al., 1999). In the case of G2, three of the four defining features of most transcription factors have been verified experimentally in heterologous systems. G2 is nuclearlocalized (Hall et al., 1998), is able to transactivate reporter gene expression, and can both homo-dimerize and heterodimerize with ZmGLK1 (Rossini et al., 2001). DNA-binding activity of GLK proteins has yet to be demonstrated,however, the putative DNA-binding domain is highly conserved with domains in other GARP proteins such as ARR1 and ARR2 (Riechmann et al., 2000). Notably, ARR1 and ARR2 have been shown to bind DNA (Sakai et al.,2000), thus it is likely that GLK proteins act as transcriptional regulators of chloroplast development.
- The GLK proteins are members of the GARP superfamily of transcription factors, and phylogenetic analysis demonstrates that the maize, rice and Arabidopsis GLK gene pairs comprise a distinct group within the GARP superfamily. Further phylogenetic analysis suggests that the gene pairs arose through separate duplication events in the monocot and dicot lineages. As in rice, AtGLK1 and AtGLK2 are expressed in partially overlapping domains in photosynthetic tissue. GLK genes therefore regulate chloroplast development in diverse plant species.
Literature and News
Gene Resources
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF14379
- InterPro: IPR009057 IPR025756
Sequences
CDS Sequence:
- >EMT02164|Aegilops_tauschii|G2-like|EMT02164
ATGGGCGGCGGCGACCGCCCCATTGTGCCGGACGCAAAATCGCCGTCGTCGACAACGTCGTCGTCCACGGAGGCCGAGAGCCGCCACAAGTCATCAAGCAAGAACTCCCACGGAAAGAAGAAAGCCAAGGTGGACTGGACGCCGGAGCTGCACCGGAGGTTCGTGCAGGCCGTAGAGCAGCTCGGCATCGACAAGGCAGTGCCGTCTAGGATTTTGGAGATCATGGGGATCAACTCACTCACTCGGCACAACATAGCAAGCCATTTGCAGAAGTACCGGTCTCACCGGAAGCACATGATTGCGCGGGAGGCGGAGGCGGCGAGCTGGACCCAACGACGACAGATGTACGCCGCCGGCGGGCCGGCCGCGGCCGTGAAGAGGCAGGACTCGAACATGTGGACCGTGCCAACCATCGGCTTCGCGCCGGCGCACCCTCCTCCTCCTCCCCCTCCTTCACCGGCAGCCATGCAGCACTACGCTCGGCCGTTGCACGTCTGGGGTCACCCTACGATGGACTCGCCCCGGATGCCGATGTGGCCGAGGCACACAATATCCCGCGCCCCGATGCCGGCGTGGGCTCCCCCGCCGCCGCCGCCGTCTGACCCGGCTTTCTGGCACCACCCTTACATGAGGGGGCCCGCAGCGTATATGCCGACCCATGGGACTCCTTGCATGGCAATGCCGATGACACCGAAATTTCCTGCTCCACCTGTGCCCGTTGCCATGCCGTGCACAGTCTATGCGCCCCCCTCCCCGGCGCCAGCGCTGGCGAGCAAGAACCAACAAGATTCGCAGCTCCAGCTACAAGCACAGCCATCAAATGAGAGCATAGACGCGGCCATTGGTGATGTTTTATCCAAACCGTGGCTGCCACTGCCTCTGGGTCTGAAGCCCCCTTCGTTGGGGAGCGTCATGGGCGAGCTCGAAAGGCAAGGCGTGGCCAATGTGCCCCAAGCCTGCGGGTGA
Protein Sequence:
- >EMT02164|Aegilops_tauschii|G2-like|EMT02164
MGGGDRPIVPDAKSPSSTTSSSTEAESRHKSSSKNSHGKKKAKVDWTPELHRRFVQAVEQLGIDKAVPSRILEIMGINSLTRHNIASHLQKYRSHRKHMIAREAEAASWTQRRQMYAAGGPAAAVKRQDSNMWTVPTIGFAPAHPPPPPPPSPAAMQHYARPLHVWGHPTMDSPRMPMWPRHTISRAPMPAWAPPPPPPSDPAFWHHPYMRGPAAYMPTHGTPCMAMPMTPKFPAPPVPVAMPCTVYAPPSPAPALASKNQQDSQLQLQAQPSNESIDAAIGDVLSKPWLPLPLGLKPPSLGSVMGELERQGVANVPQACG