Information report for Cla013124
Gene Details
Functional Annotation
- Refseq: XP_022983635.1 — transcription repressor KAN1-like isoform X1
- Refseq: XP_022983636.1 — transcription repressor KAN1-like isoform X1
- Swissprot: Q93WJ9 — KAN1_ARATH; Transcription repressor KAN1
- TrEMBL: A0A0A0LBR3 — A0A0A0LBR3_CUCSA; Uncharacterized protein
- STRING: XP_004140729.1 — (Cucumis sativus)
- GO:0009887 — Biological Process — organ morphogenesis
- GO:0009944 — Biological Process — polarity specification of adaxial/abaxial axis
- GO:0009956 — Biological Process — radial pattern formation
- GO:0010051 — Biological Process — xylem and phloem pattern formation
- GO:0010158 — Biological Process — abaxial cell fate specification
- GO:0010229 — Biological Process — inflorescence development
- GO:0048481 — Biological Process — plant ovule development
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- The GLK proteins are members of the recently categorized GARP superfamily of transcription factors (Riechmann et al., 2000) defined by G2 in maize; the Arabidopsis RESPONSE REGULATOR-B (ARR-B) proteins (Imamura et al., 1999); and the PHOSPHATE STARVATION RESPONSE1 (PSR1) protein of Chlamydomonas (Wykoff et al., 1999). In the case of G2, three of the four defining features of most transcription factors have been verified experimentally in heterologous systems. G2 is nuclearlocalized (Hall et al., 1998), is able to transactivate reporter gene expression, and can both homo-dimerize and heterodimerize with ZmGLK1 (Rossini et al., 2001). DNA-binding activity of GLK proteins has yet to be demonstrated,however, the putative DNA-binding domain is highly conserved with domains in other GARP proteins such as ARR1 and ARR2 (Riechmann et al., 2000). Notably, ARR1 and ARR2 have been shown to bind DNA (Sakai et al.,2000), thus it is likely that GLK proteins act as transcriptional regulators of chloroplast development.
- The GLK proteins are members of the GARP superfamily of transcription factors, and phylogenetic analysis demonstrates that the maize, rice and Arabidopsis GLK gene pairs comprise a distinct group within the GARP superfamily. Further phylogenetic analysis suggests that the gene pairs arose through separate duplication events in the monocot and dicot lineages. As in rice, AtGLK1 and AtGLK2 are expressed in partially overlapping domains in photosynthetic tissue. GLK genes therefore regulate chloroplast development in diverse plant species.
Literature and News
Gene Resources
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF14379
- InterPro: IPR009057 IPR025756
Homologs
- Cajanus cajan: C.cajan_19643
- Cucumis melo: MELO3C019573P1
- Cucumis sativus: Cucsa.108670.1, Cucsa.108670.3, Cucsa.108670.2, Cucsa.108670.4
- Glycine max: Glyma.18G043000.4.p, Glyma.18G043000.2.p, Glyma.18G043000.5.p, Glyma.18G043000.1.p, Glyma.11G213700.2.p, Glyma.11G213700.1.p, Glyma.18G043000.6.p, Glyma.18G043000.3.p
- Juglans regia: WALNUT_00001242-RA
- Lotus japonicus: Lj0g3v0089499.1
- Manihot esculenta: Manes.01G121700.1.p, Manes.02G079700.1.p
- Prunus mume: XP_008244321.1
- Solanum lycopersicum: Solyc11g011770.1.1
- Solanum tuberosum: PGSC0003DMP400023570
- Vitis vinifera: GSVIVT01026319001
Sequences
CDS Sequence:
- >Cla013124|Citrullus_lanatus|G2-like|Cla013124
ATGGGTTATCATCATCATCATCATCGAGGCAGCGGAGTTGGAGGAAATAATAATAATAATAATAATAATAATTGTTCAGCGAGGTTCAACAATGGGGTTGTTTCAGTAGAAGGAATTAAATGTTTGAATAATAATGTTAATAGTAATAATAGTAATGCAGCTTCTTCTTCTTCTTCTGATGTTTGTTCTCATGGGATGATGATGATGAGATCCAGATTTTTGCAGAAGCTTCCTGCAAAACGAAGCATGAGAGCTCCTAGAATGAGATGGACTACCTCCTTACATGCTCGCTTCGTTCATGCTGTCGAACATCTCGGCGGCCATGAAAGAGCAACACCAAAGTCAGTTCTTGAGCTTATGGATGTTAAGGATCTAACATTAGCTCATGTCAAAAGCCATTTACAGATGTATCGAACTGTTAAGACCACTGACAAACCTGCAGCTTCCTCAGGCCAATCGGATGGTTCGGGAGAGGATGATGCATCTCCTACAATGGACACAACCAGAGGGGATCATGGTGCCAAGCAATTTTCCGATCAAAGAGCTCCGCCCGACCGGTCCGGCCAGCCGCTGCCAGAGTTGGAATTTGGCTCCTCCACACTTTGGTCTAATTCTTCAAGAGATGTTTGGCCACAAAGAAACTCTAATGACATGGATGTCATAACACCAACTTTCATGTCTACACAACAAAAATCCATGCACCAAATTCAGGAATGTGATTCAGGTGTAATGAAGAGATACAATTCAGAATTCAAGAAACCAAGCTTGGAGTTCAGATTAGGCAGAGCAGAGTGGGATGTGAAACAAGACTAA
Protein Sequence:
- >Cla013124|Citrullus_lanatus|G2-like|Cla013124
MGYHHHHHRGSGVGGNNNNNNNNNCSARFNNGVVSVEGIKCLNNNVNSNNSNAASSSSSDVCSHGMMMMRSRFLQKLPAKRSMRAPRMRWTTSLHARFVHAVEHLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVKTTDKPAASSGQSDGSGEDDASPTMDTTRGDHGAKQFSDQRAPPDRSGQPLPELEFGSSTLWSNSSRDVWPQRNSNDMDVITPTFMSTQQKSMHQIQECDSGVMKRYNSEFKKPSLEFRLGRAEWDVKQD