Information report for Neem_3898_f_3
Gene Details
|
|
Functional Annotation
- Refseq: XP_006481370.1 — protein FAR-RED ELONGATED HYPOCOTYL 3 isoform X1
- Refseq: XP_024037340.1 — protein FAR-RED ELONGATED HYPOCOTYL 3
- Refseq: XP_024037341.1 — protein FAR-RED ELONGATED HYPOCOTYL 3
- Refseq: XP_024037342.1 — protein FAR-RED ELONGATED HYPOCOTYL 3
- Refseq: XP_024037343.1 — protein FAR-RED ELONGATED HYPOCOTYL 3
- Refseq: XP_024955384.1 — protein FAR-RED ELONGATED HYPOCOTYL 3 isoform X1
- Refseq: XP_024955385.1 — protein FAR-RED ELONGATED HYPOCOTYL 3 isoform X1
- Refseq: XP_024955386.1 — protein FAR-RED ELONGATED HYPOCOTYL 3 isoform X1
- Refseq: XP_024955387.1 — protein FAR-RED ELONGATED HYPOCOTYL 3 isoform X1
- Swissprot: Q9LIE5 — FHY3_ARATH; Protein FAR-RED ELONGATED HYPOCOTYL 3
- TrEMBL: A0A3N6QE62 — A0A3N6QE62_BRACR; Uncharacterized protein
- STRING: XP_006481370.1 — (Citrus sinensis)
- GO:0009585 — Biological Process — red, far-red light phototransduction
- GO:0010218 — Biological Process — response to far red light
- GO:0042753 — Biological Process — positive regulation of circadian rhythm
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0008270 — Molecular Function — zinc ion binding
Family Introduction
- We show that Arabidopsis FHY3 and FAR1, which encode two proteins related to Mutator-like transposases, act together to modulate phyA signaling by directly activating the transcription of FHY1 and FHL, whose products are essential for light-induced phyA nuclear accumulation and subsequent light responses. FHY3 and FAR1 have separable DNA binding and transcriptional activation domains that are highly conserved in Mutator-like transposases. Further, expression of FHY3 and FAR1 is negatively regulated by phyA signaling. We propose that FHY3 and FAR1 represent transcription factors that have been co-opted from an ancient Mutator-like transposase(s) to modulate phyA-signaling homeostasis in higher plants.
- We next used a yeast one-hybrid assay to delineate the DNA sequences to which FHY3 and FAR1 bind. GAD-FHY3 or GAD-FAR1 fusion proteins (GAD, GAL4 transcriptional activation domain), but not GAD alone, activated the LacZ reporter genes driven by the FHY1 and FHL promoters. Deletion analysis narrowed down the FHY3/FAR1 binding site to a 39-bp promoter subfragment located on the ‘a’ fragment for both FHY1 and FHL. Notably, these subfragments share a stretch of consensus sequence, 5’-TTCACGCGCC-3’. Mutating the core sequence ‘CACGCGC’ of this motif (m2 and m3 for FHY1, m5 for FHL) abolished the reporter gene activation by both GAD-FHY3 and GAD-FAR1. Mutating the flanking sequences (m1 and m4) did not obviously affect the reporter gene activation by GAD-FAR1, but clearly reduced activation by GAD-FHY3. Thus, ‘CACGCGC’ likely defines a cis-element that confers specific binding for FHY3 and FAR1 and is named FBS for FHY3-FAR1 binding site.
Literature and News
Homologs
- Fragaria vesca: mrna24214.1-v1.0-hybrid
- Populus trichocarpa: Potri.016G018300.6, Potri.016G018300.5, Potri.016G018300.4, Potri.016G018300.3, Potri.006G020700.6, Potri.006G020700.5, Potri.006G020700.3, Potri.006G020700.2, Potri.016G018300.1
- Prunus mume: XP_008229656.1
- Prunus persica: Prupe.3G186200.3.p, Prupe.3G186200.1.p
- Raphanus raphanistrum: RrC1813_p1
- Ziziphus jujuba: XP_015880907.1
Sequences
CDS Sequence:
- >Neem_3898_f_3|Azadirachta_indica|FAR1|Neem_3898_f_3
Protein Sequence:
- >Neem_3898_f_3|Azadirachta_indica|FAR1|Neem_3898_f_3
MDIDLRLPSGEQAKEEEEQNGIDNMLDGEEKLALHNGDVETGNIAVVDEVRAEDGGGVNSPAEDMVVFKEDTNLEPLSGMEFESHGEAYSFYQEYARSMGFNTAIQNSRRSKTSREFIDAKFACSRYGTKREYDKSYNRPRARQSKQDQENATGRRSCAKTDCKASMHVKRRPDGKWVIHSFVKEHNHELLPAQAVSEQTRKMYAAMARQFAEYKSVVGLKNDPKNPFDKGRNLALELGDAKILLDFFTQMQNMNANFFYAVDLDRYEEEAKADSDTWNKQPALKSPSPFEKSVSAIYTHAVFKKFQVEVLGAVACHPKQESQNEANVMFRVQDFEKNQDFIVMWNQMKSEVFCVCRLFEYKGYLCRHALIVLQIRGLSAIPSQYILKRWTRDAKSRQLLGEESDQIQSRVQRYNDLCQRAMKLSEEGSLSQESYGVALRALDEALANCSSVNTSNKSLVEAVTSPTHGLICIEEDNQSRSMSKTNKRKNPTKKRKVNSEQEVMTVGAQDSLQQMEKLNSRAVTSLDGYYGTQQSVQGMVQLNLMAPTRDNYYSNQQTIQGLGQLNSIAPSHDGYYSAQQGMHGLGQMDFFRTPTSFTYGIRDDPNVRTAQLQDDASRHA