Gene Details:
- Gene ID: Cc00_g35310
- Gene Name: GSCOC_T00007535001
- Gene Family: E2F/DP Family
- Description: E2F/DP Family protein
- Species: Coffea canephora
- Source: E2F-DP family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:1.10.10.10
- SuperFamily: SSF144074
- Pfam: PF16421
- InterPro: IPR011991 IPR032198
Annotation Proteins:
- Refseq: XP_027174750.1 — transcription factor E2FA-like
- Swissprot: Q9FNY0 — E2FA_ARATH; Transcription factor E2FA
- TrEMBL: A0A068VNG9 — A0A068VNG9_COFCA; Uncharacterized protein (Fragment)
- STRING: XP_010262959.1 — (Nelumbo nucifera)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0005667 — Cellular Component — transcription factor complex
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction:
- E2F transcription factors are a family of proteins that share a related DNA-binding domain and that bind to overlapping sets of target promoters. Most E2F proteins associate with a DP protein and form heterodimeric complexes that bind to DNA in a sequence-specific manner. E2F proteins control the temporal expression of genes that are needed for multiple processes during the cell cycle. Consequently, the level of E2F-dependent transcription is important for cell proliferation.
- Different types of E2F complexes either activate or repress transcription. E2F repressor complexes suppress the transcription of their targets in quiescent cells, in differentiated cells and during the G1 phase of the cell cycle. When cells enter the cell cycle and proliferate, these repressors are disrupted and/or replaced by activator forms of E2F that promote gene expression.
Literature:
Sequences:
CDS Sequence:
- >Cc00_g35310|Coffea_canephora|E2F/DP|Cc00_g35310
ATGTCTGGAGGAAACGCATACAGATCAAAGGTCACACCTTTAACTCCTTTGTTCAATGCCAAAGGAGGAAAAGCAAGGAGCTGCCGCAATGACAGATCTTTGGGTCTTCAGACAAAAAATTTCGTCAACTTGATAAAGCATGCAGAGGATGGAATTCTTGATTTGAACGAGGCAGCAAAGACGTTGGAGATGTCAAAAAGACGGATATATGATATTACAAGTGTTCTTGGAGGAATTGGTCTAATTGAAAAGGAATTGAAAAGTACAATCCGTTGGACAGGCCTTGGTGCGTCAAGACAACCAGATCTGCAGGCAGAAGTTGAGAATCTTTCCATGGAAGAACGAAGATTAGATGATCGAATCAGGTTAGAGATGCAAGAAAGATTGAGGGATTTGAGTGCAATCAATCAGAAATGGCTTTTTGTGACTTTCGAGGATATCAAGGTTGTGCCTTGCTTTCAGGTACTTTTTTATTGTTTTGTTGTGTGGCAATTTCTGTTCAGT
Protein Sequence:
- >Cc00_g35310|Coffea_canephora|E2F/DP|Cc00_g35310
MSGGNAYRSKVTPLTPLFNAKGGKARSCRNDRSLGLQTKNFVNLIKHAEDGILDLNEAAKTLEMSKRRIYDITSVLGGIGLIEKELKSTIRWTGLGASRQPDLQAEVENLSMEERRLDDRIRLEMQERLRDLSAINQKWLFVTFEDIKVVPCFQVLFYCFVVWQFLFS