Gene Details:

  • Gene ID: GRMZM2G142718_P01
  • Gene Name: LOC100272945, ZEAMMB73_236362
  • Gene Family: Dof Family
  • Description: Dof Family protein
  • Species: Zea mays
  • Source: Dof family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_001140869.1  — Dof zinc finger protein DOF1.6
  • TrEMBL:  B4FRV3  — B4FRV3_MAIZE; Dof zinc finger protein DOF1.6
  • TrEMBL:  K0D9K7  — K0D9K7_MAIZE; DOF41 transcription factor (Fragment)
  • STRING:  GRMZM2G142718_P01  — (Zea mays)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • Dof (DNA binding with one finger) family, a particular class of zinc finger domain TFs characterized by a conserved region of 50 amino acids with a C2-C2 finger structure, associated to a basic region, that binds specifically to DNA sequences with a 5’-T/AAAAG-3’ core. Dof proteins have been reported to participate in the regulation of gene expression in processes such as seed storage protein synthesis in developing endosperm, light regulation of genes involved in carbohydrate metabolism, plant defense mechanisms, seed germination, gibberellin response in post-germinating aleurone , auxin response and stomata guard cell specific gene regulation.

Literature:

Sequences:

CDS Sequence:
  • >GRMZM2G142718_P01|Zea_mays|Dof|GRMZM2G142718_P01
    ATGGCGCCTGCAGCTTCGATCCTCTCGGTCACCGCCGTCGCCGGTTCCAAGCGTCCGGCCGCTTCCGACGCTGAGCTCCCGCTCCTCGACCTCGACTCCTCCTCGCTCCACCAGCAGCAGGGTGACAAGGCTGGGCGCAAGGGCCAGGACCAGGACCACCACCAGCAGCAGCAGCTGGAGTGCCCGCGCTGCCGCTCCACCAACACCAAGTTCTGCTACTACAACAACTACAGCACGGCGCAGCCGCGCCACTTCTGCCGCGCGTGCCGCCGCTACTGGACGCACGGCGGCACGCTGCGCGACGTCCCGGTTGGCGGGGCCTCGCGCCGCGCCGGTGGGGGCGGCAAGCGGCGCAGGGTCTCCTCCGCCGAGACCTCGTCGTCGTCGCCGCCGGTGCCTGCGTCGCTCGCGGACGCGTGCCTGTCCGACCTCCCGTCCGTCTTCCCGTTCCTCAGCGACGGCAGCTTCTTCCCGCAGCTCGACCTCGGCGCCGTCGTGCTTGCACCGCCGGCCTTCTCCTCCTCGTGGCGGTCGGTGGCCCCGGACTTCTACGACGGGCTCGCGCCGTGGGGCGACATCGCCGGCCTCGACCTCAGCTGGACACCACCGGGGAGCGCCAGCCGGTCGCCGTCTTGA
Protein Sequence:
  • >GRMZM2G142718_P01|Zea_mays|Dof|GRMZM2G142718_P01
    MAPAASILSVTAVAGSKRPAASDAELPLLDLDSSSLHQQQGDKAGRKGQDQDHHQQQQLECPRCRSTNTKFCYYNNYSTAQPRHFCRACRRYWTHGGTLRDVPVGGASRRAGGGGKRRRVSSAETSSSSPPVPASLADACLSDLPSVFPFLSDGSFFPQLDLGAVVLAPPAFSSSWRSVAPDFYDGLAPWGDIAGLDLSWTPPGSASRSPS