Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_008657203.1  — protein tesmin/TSO1-like CXC 5
  • Refseq:  XP_025815944.1  — LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 5
  • TrEMBL:  A0A3L6SJ42  — A0A3L6SJ42_PANMI; Protein tesmin/TSO1-like CXC 5 isoform X1
  • STRING:  Pavir.Eb03237.1.p  — (Panicum virgatum)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >Zmw_sc00166.1.g00380.1|Zoysia_matrella|CPP|Zmw_sc00166.1.g00380.1
Protein Sequence:
  • >Zmw_sc00166.1.g00380.1|Zoysia_matrella|CPP|Zmw_sc00166.1.g00380.1
    MAGKDRSGGGPPQLPPMPAVSTQPPIKKLVRQLDFNSAAMAGNPAMAAAAAAAVSRALQPRAVHVGFPLQQHPRAAAPLGVSQQLQHRGLPVLRPHHVVGHLPLPRMAVTVPVPQLRPIPVQPVLRPPVAVSLKPESPKPWAKLNEGKDGTGTPTKKKCCNCRNSRCLKLYCECFASGSYCDGCNCTNCFNNLENDVARREAIDATLERNPDAFRPKIGSSPLANRSNEASGDLPLIGKHNKGCHCKKSSCLKKYCECFQANILCSENCKCIDCKNFEGSEERKALFQGDHKNAIHMQQAANAAVNGAIGVAGFPSPSASRKRKHIDPSLDRSNRQHVANKNCQLPQNAIPDGSVPIDQSVHPPTLGPFKVTYRPLLADIVQADDIKELCKLLVVVSGEAAKAYTGRKTQEEKEAKEEDNKAGPGMSTNHDREENNQDTDKKTLINDTSSGGIHTDKTLQEEYRTNCADDQKSKERYSMAIKTEASGHPGQVTGVSRVPYSKLDVPAVVKTFPQSSSS