Gene Details:

  • Gene ID: XP_013892784.1
  • Gene Family: CPP Family
  • Description: CPP Family protein
  • Species: Monoraphidium neglectum
  • Source: CPP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_013892784.1  — hypothetical protein MNEG_14200
  • Swissprot:  Q9SL70  — TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
  • TrEMBL:  A0A0D2LPU6  — A0A0D2LPU6_9CHLO; Uncharacterized protein
  • STRING:  XP_009346088.1  — (Pyrus x bretschneideri)

Family Introduction:

  • CPP-like (cystein-rich polycomb-like protein) proteins are members of a small transcription factor family whose typical feature is the existence of one or two similar Cys-rich domains termed the CXC domain. The members of this family are widely present in plants and animals but absent in yeast, and the CXC domains of CPP-like proteins show high conservation across species from amoebae though plants to mammals (Andersen et al. 2007; Riechmann et al. 2000). CPP-like genes play an important role in development of reproductive tissue and control of cell division in plants.

Literature:

Sequences:

CDS Sequence:
  • >XP_013892784.1|Monoraphidium_neglectum|CPP|XP_013892784.1
    ATGCCGCTGCAGGCATTCATGCAGGGGCCCCAGGCAGCCAAACGCTGCGCCTGCAAGAAGGCGCGATGCCTCAAGCTGTATTGCGTCTGCTTCGCGGCAGGCATGTTCTGCGACGGGTGCAGCTGCGACAAGTGCCAGAACACCGAGAAAGACCAGTCCATCGTGATGCAGCAGCGCGGCCGCGTGCTGGCGCGCAACCCGCAGTCCTTCCTGCCGAAGGAGCGCCGCCCGGAATGA
Protein Sequence:
  • >XP_013892784.1|Monoraphidium_neglectum|CPP|XP_013892784.1
    MPLQAFMQGPQAAKRCACKKARCLKLYCVCFAAGMFCDGCSCDKCQNTEKDQSIVMQQRGRVLARNPQSFLPKERRPE